Conserved Protein Domain Family
mraY

?
TIGR00445: mraY 
phospho-N-acetylmuramoyl-pentapeptide-transferase
Involved in peptidoglycan biosynthesis, the enzyme catalyzes the first of the lipid cycle reactions. Also known as Muramoyl-Pentapeptide Transferase (murX). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
Statistics
?
PSSM-Id: 161884
View PSSM: TIGR00445
Aligned: 6 rows
Threshold Bit Score: 394.89
Threshold Setting Gi: 239938662
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P15876  37 SLWMGPRMIAHLQKLSFGQVVRNDGPeSHFSKR-GTPTMGGIMILTAIVISVLLWAYPS---NPYVWCVLVVLVGYGVIG 112 Escherichia coli
O25235  33 TLFLMPKFILWAKAKKANQPISSFVP-SHQNKK-DTPTMGGIVFVFATIVASVLCASLG---NLYVLLGLIVLVGFSFVG 107 Helicobacter pylori 2...
P45062  37 SLWIGPKVIKRLQILKFGQEVRNDGPeSHFAKK-GTPTMGGVMILFSIGVSTLLWANLA---NPYIWVCLFVLFGYGAIG 112 Haemophilus influenza...
Q03521  17 SVLLSPILIPFLRRLKFGQSIREEGPkSHQKKS-GTPTMGGVMIILSIIVTTIVMTQKFseiSPEMVLLLFVTLGYGLLG 95  Bacillus subtilis sub...
Q44776  28 SLIVGPYIILKLKKLRADQILREDGPkRHLSEKaGIPTMGGILIFFCVFISLVFWSNIL---NVYFLIMVFVMLGFAFLG 104 Borrelia burgdorferi B31
Q55986  60 TALIGMAVVPMLVNLKASQVIQSDGPqSHLKKA-GTPTMGGIFFVPVAVAIAVVGTQF----NPDVIVVGLVTLGYMAIG 134 Synechocystis sp. PCC...
P15876 113 FVDDYRKVVRKDTKGLIARWKYFWMSVIALGVAFALYLAGKDTpatQLVVPFFKDVMPQLG-LFYILLAYFVIVGTGNAV 191 Escherichia coli
O25235 108 FRDDYTKINQQSNAGMSAKMKFGMLFILSLIVSVLLSLKGLDT---FLYAPFLKNPLFEMPtMLAVGFWVLVFLSTSNAV 184 Helicobacter pylori 2...
P45062 113 FVDDFRKITRKNTDGLIARWKYFWMSVVALVAILWLYWLGHDTdatRLVIPFFKDIMPQLG-LFYIVLSYFVIVGTGNAV 191 Haemophilus influenza...
Q03521  96 FLDDYIKVVMKRNLGLTSKQKLIGQIIIAVVFYAVYHYYNFAT---DIRIPG-TDLSFDLG-WAYFILVLFMLVGGSNAV 170 Bacillus subtilis sub...
Q44776 105 FIDDFLKIKKKTSDGLKARFKIYGQIIFSFFSVGILYYFGGEHv-sVIYFPFIKSFQIDLG-LFYIPFGMFILISASNSF 182 Borrelia burgdorferi B31
Q55986 135 WVDDWQILKYKSNKGLTPKQKLFLQVAIAVIFCTWLFFYGPTE----ITDIRIMQFVLPLG-FLFWLVATFALVAESNAT 209 Synechocystis sp. PCC...
P15876 192 NLTDGLDGLAIMPTVFVAGGFALVAWATGNMNFASYLHIPYLRHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSL 271 Escherichia coli
O25235 185 NLTDGLDGLASVPSIFTLLSLSIFVYVAGNAEFSKYLLYPKVIDVGELFVVSLALVGSLFGFLWYNCNPASVFMGDSGSL 264 Helicobacter pylori 2...
P45062 192 NLTDGLDGLAIMPTALVAGAFALIAWATGNVNFAEYLHIPYIKYSSEVVVFCTAIVGASLGFLWFNTYPAQVFMGDVGSL 271 Haemophilus influenza...
Q03521 171 NLTDGLDGLLSGTAAIAFGAFAILAWNQ-----SQY--------DV--AIFSVAVVGAVLGFLVFNAHPAKVFMGDTGSL 235 Bacillus subtilis sub...
Q44776 183 NLTDGLDGLAIGLSIVITGALIIIAYLTSRADFAAYLHIPNIKGSEELVIFLGALLGGSFGFLWFNAYPAKIMMGDTGSL 262 Borrelia burgdorferi B31
Q55986 210 NLTDGVDGLAAGTGAIAFVGLGLLVAKE-----N-----PAL------AFFCCAMAGGCIGFVHHNHNPARVFMGDTGSL 273 Synechocystis sp. PCC...
P15876 272 ALGGALGIIAVLLRQEFLLVIMGGVFVVETLSVILQVGSFKLRG------QRIFRMAPIHHHYELKGWPEPRVIVRFWII 345 Escherichia coli
O25235 265 ALGGFIAYNAIVSHNEILLVLMGSIFVIETLSVILQVGSYKTRK------KRLFLMAPIHHHFEQKGWAENKVIVRFWII 338 Helicobacter pylori 2...
P45062 272 ALGGALGVVAILVRQEFLLVIMGGVFVVEALSVILQVGSYKLRK------QRIFRMAPIHHHFELKGWPEPRVIIRFWII 345 Haemophilus influenza...
Q03521 236 ALGGAIVTIAILTKLEILLVIIGGVFVIETLSVILQVISFKTTG------KRIFKMSPLHHHYELVGWSEWRVVVTFWAA 309 Bacillus subtilis sub...
Q44776 263 ALGAILGMAALILKSEILFSILAGVFIIETMSVIIQVLVYKKTK------KRVFKMAPLHHHFEELGWSEMQVVIRFWII 336 Borrelia burgdorferi B31
Q55986 274 ALGGSLAAVGIMTGNLWGLLLISGIFLAESLSVIAQVGYYKATKgpdgvgKRLLKMAPIHHHLELSGWTETQIVGSFYLI 353 Synechocystis sp. PCC...
P15876 346 SLMLVLIG-LATLKVR 360 Escherichia coli
O25235 339 SMLSNLVA-LLSLKVR 353 Helicobacter pylori 26695
P45062 346 SLMLVLMG-LVTLKLR 360 Haemophilus influenzae Rd KW20
Q03521 310 GLLLAVLGiYIEVWL- 324 Bacillus subtilis subsp. subtilis str. 168
Q44776 337 GLIFAIIA-LSTIKIR 351 Borrelia burgdorferi B31
Q55986 354 NTLLAIVA-MATA--- 365 Synechocystis sp. PCC 6803 substr. Kazusa
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap