2I22


Conserved Protein Domain Family
gmhA

?
TIGR00441: gmhA 
Click on image for an interactive view with Cn3D
phosphoheptose isomerase
This model describes phosphoheptose isomerase. Because a closely related paralo in Escherichia coli differs in function (DnaA initiator-associating protein diaA), this model has been rebuilt with a high stringency, and is likely to miss many true examples for phosphoheptose isomerase. Involved in lipopolysaccharide biosynthesis it may have a role in virulence in Haemophilus ducreyi. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
Statistics
?
PSSM-Id: 129533
View PSSM: TIGR00441
Aligned: 5 rows
Threshold Bit Score: 284.449
Threshold Setting Gi: 159794805
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2I22_A  54 AVLLADSFKAGGKVLSCGNGGSHCDAMHFAEELTGRYRENRPGYPAIAIS-DVSHISCVGNDFGFNDIFSRYVEAVGREG 132 Escherichia coli
O25528  32 VHLLIETLENQGKILICGNGGSASDAQHFAAELTGRYKLERKGLSAISLNtDISALTAIANDYGYEEVFARQVEALGVKN 111 Helicobacter pylori 2...
P45093  34 ALLISNSFKQGGKVLSCGNGGSHCDAMHFAEELTGRYRENRPGYPAIAIS-DASHLSCVSNDFGYEYVFSRYVEAVGQKG 112 Haemophilus influenza...
P51001  34 AVLLADSFKAGGKVLSCGNGGSHCDAMHFAEELTGRYRENRPGYPAIAIS-DVSHISCVGNDFGFNDIFSRYVEAVGREG 112 Escherichia coli
Q55797  28 VDLICQRFQAGNKLLICGNGGSAADAQHLAAEFVGRFHFNRQALPAIALTaNSSILTSVSNDYTYDIVFSRQVEALGQPG 107 Synechocystis sp. PCC...
2I22_A 133 DVLLGISTSGNSANVIKAIAAAREKGMKVITLTGKDGGKMAGTADIEIRVPHFgYADRIQEIHIKVIHILIQLIE 207 Escherichia coli
O25528 112 DVLIGISTSGNSKNVLKAYEKAKDLEMKTLSLAGRDGGKMKPLSDMALIVPSD-DTPRIQEMHILMIHILCDCIE 185 Helicobacter pylori 26695
P45093 113 DVLFGLSTSGNSKNILNAIEAAKTKGMKVIAMTGKDGGKMAGLADVEIRVPHFrYADRIQEIHIKVIHILMMLIE 187 Haemophilus influenzae Rd ...
P51001 113 DVLLGISTSGNSANVIKAIAAAREKGMKVITLTGKDGGKMAGTADIEIRVPHFgYADRIQEIHIKVIHILIQLIE 187 Escherichia coli
Q55797 108 DILWGLSTSGKSTNVLHALKCAKDKGLHTIGMAGNNGGLFQEFADYPLFVADK-NTPCIQEVHLMTYHHICEQVE 181 Synechocystis sp. PCC 6803...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap