Conserved Protein Domain Family
ftsX

?
TIGR00439: ftsX 
putative protein insertion permease FtsX
FtsX is an integral membrane protein encoded in the same operon as signal recognition particle docking protein FtsY and FtsE. It belongs to a family of predicted permeases and may play a role in the insertion of proteins required for potassium transport, cell division, and other activities. FtsE is a hydrophilic nucleotide-binding protein that associates with the inner membrane by means of association with FtsX. [Cellular processes, Cell division, Protein fate, Protein and peptide secretion and trafficking]
Statistics
?
PSSM-Id: 129531
View PSSM: TIGR00439
Aligned: 3 rows
Threshold Bit Score: 468.18
Threshold Setting Gi: 7387692
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P10122  40 SSPKpvNrkTNVFnEQVRYAFHGALQDLKSKPFATFLTVMVIAISLTLPSVCYMVYKNVNQAATQYYPSPQITVYLQKTL 119 Escherichia coli
P44872   2 SRST--D--ASVF-VQTAYTLRAVWADLWQRKFGTLLTILVIAVSLTIPTVSYLMWKNLHLATTQFYPESELTIYLHKNL 76  Haemophilus influenza...
P95357   2 SIIH--Y-----FsLHVESARSALKQLLR-QPFGTLLTLIMLAVAMTLPLFMYLGIQSGQSVLGKLNESPQITVYMETAA 73  Neisseria gonorrhoeae
P10122 120 DDDAAAGVVAQLQAEQGVEKVNYLSREDALGEFRNWSGFGGALDMLEENPLPAVAVVIPKLDFQGTESLNTLRDRITQIN 199 Escherichia coli
P44872  77 SEENANLVVEKIRQQKGVESLNYVSRQESLKEFKSWSGFGEELEILDDNPLPAVVIVKPTSEFNVSEKRDELRTNLNKIK 156 Haemophilus influenza...
P95357  74 AQSDSDTVRSLLTRDKRLDNIRFIGKEDGLAELQS-NLDQNLISMLDGNPLPDVFIVTPDPATTPAQMQAIYRD-ITKLP 151 Neisseria gonorrhoeae
P10122 200 GIDEVRMDDSWFARLAALTGLVGRVSAMIGVLMVAAVFLVIGNSVRLSIFARRDSINVQKLIGATDGFILRPFLYGGALL 279 Escherichia coli
P44872 157 GVQEVRLDNDWMEKLTALSWLIAHVAIFCTVLMTIAVFLVIGNSIRSDVYSSRSSIDVMKLLGATDQFILRPYLYTGMIY 236 Haemophilus influenza...
P95357 152 MVESASMDTEWVQTLYQINEFIRKILWFLSLTLGMAFVLVAHNTIRLQILSRKEEIEITKLLGAPASFIRRPFLYQAMWQ 231 Neisseria gonorrhoeae
P10122 280 GFSGALLSLILSEILVLRLSSAVAEVAQVFGTKFDINGLSFDECLLLLLVCSMIGWVAAWLATVQHLRHFTPE 352 Escherichia coli
P44872 237 ALLGGLVAAIFSSFIISYFTSAVKYVTDIFAVQFSLNGLGVGEFVFLLVCCLIMGYVGAWIAATRHIAMMERK 309 Haemophilus influenzae Rd KW20
P95357 232 SIFSAAVSLGLCGWLLSAVRPLVDAIFKPYGLNIGWRFFYVGELGLVFGFVIALGVFGAWLATTQHLLCFKAK 304 Neisseria gonorrhoeae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap