1EGA


Conserved Protein Domain Family
era

?
TIGR00436: era 
Click on image for an interactive view with Cn3D
GTP-binding protein Era
Era is an essential GTPase in Escherichia coli and many other bacteria. It plays a role in ribosome biogenesis. Few bacteria lack this protein. [Protein synthesis, Other]
Statistics
?
PSSM-Id: 129528
View PSSM: TIGR00436
Aligned: 8 rows
Threshold Bit Score: 340.52
Threshold Setting Gi: 3334175
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1EGA_A   9 GFIAIVGRPNVGKSTLLNKLLGQKISITSRKAQTTRHRIVGIHTEGAYQ-AIYVDTPGLHmEE-KRAINRLMNKAASSSI 86  Escherichia coli BW2952
P43728  11 GFIAIVGRPNVGKSTLLNKILGQKISITSRKAQTTRHRIVGIKTEGAYQ-EIYVDTPGLH-IEeKRAINRLMNRAASSAI 88  Haemophilus influenza...
P06616   9 GFIAIVGRPNVGKSTLLNKLLGQKISITSRKAQTTRHRIVGIHTEGAYQ-AIYVDTPGLH-MEeKRAINRLMNKAASSSI 86  Escherichia coli K-12
P42182   9 GFVSIIGRPNVGKSTFLNRVIGQKIAIMSDKPQTTRNKVQGVLTTGTSQ-TIFIDTPGIH-KP-KHKLGDFMMKVAQNTL 85  Bacillus subtilis sub...
Q55526  23 GFVAIVGRPNVGKSTLMNQLVGQKIAITSPVAQTTRNRLQGIITTPSSQ-IILLDTPGIH-KP-HHELGRVLVKNAIQAI 99  Synechocystis sp. PCC...
O51604   4 GFAAILGRPSTGKSTLLNSICGHKISIISPIPQTTRNNIKGIFTDDRGQ-IIFIDTPGFH-LS-KKKFNIAMMKNIHSSI 80  Borrelia burgdorferi B31
P47627   4 LKVGVLGPTNAGKSTLINFLHNDDSLMVSSMNNTTLLSISTEVINQANKnIVFIDVPGFT-EK-KHSNYELITKEIRKAL 81  Mycoplasma genitalium...
P75210   4 IRIGVLGLTNAGKSTLVNQLHKANNLLVSPMNNTTLLAVSTNTITHEKQnITFIDVPGFS-EK-RHSSYELISQEIRKAL 81  Mycoplasma pneumoniae...
1EGA_A  87 GDVELVIFVVEGTRWTPDd-EMVLNKLREGKAPVILAVNKVDNvQ-EKADLLPHLQFLASQMNFL--DIVPISAETGLNV 162 Escherichia coli BW2952
P43728  89 GDVDLIIFVVDGTHWNADd-EMVLNKLRNAKAPVVLAINKVDN-IkNKDDLLPFITDLSSKFNFA--HIVPISAQRGNNV 164 Haemophilus influenza...
P06616  87 GDVELVIFVVEGTRWTPDd-EMVLNKLREGKAPVILAVNKVDN-VqEKADLLPHLQFLASQMNFL--DIVPISAETGLNV 162 Escherichia coli K-12
P42182  86 KEVDLILFMINAEEGYGKgdEFIIEKLQTMSTPVFLIVNKIDK-I-HPDQLLLLIDEYRKRYPFK--EIVPISALEGNNI 161 Bacillus subtilis sub...
Q55526 100 HSVDLVVFLVDSSATLGRgdRFVVDLLQKTDGPVVVGLNKQDQ-Q-PPDQREELNASYETLTENHgwPCFKFSALTGEGL 177 Synechocystis sp. PCC...
O51604  81 GEVELILYIIDIQDKPGEeeNKMLEIIKNSKIKFLVILNKIDL-KnTKIKEITQFLKEKGIEDS---NIIKISAEKKINT 156 Borrelia burgdorferi B31
P47627  82 SGIDVLLLVVRSDQNNKI--EFLKTQLQQLKRYQNLTRIFLIN-K-FHQKSLSEVNKAIILEEFKpqKTIEINLLKFDKN 157 Mycoplasma genitalium...
P75210  82 SGIDVLLLVVRSDQQQKL--PLLQTQLQPLKRYRDLTRVLLIN-N-FFDVVLQAEDKQAIVLDFKpqAVLETDLLHFDAT 157 Mycoplasma pneumoniae...
1EGA_A 163 DTIAAIVRKHLPEATHHFPEDYITDRSQRFMASEIIREKLMRFLGAELPYSVTVEIERFVSN-ERGGYDINGLILVEREG 241 Escherichia coli BW2952
P43728 165 HELEKIVRQSLREGVHHFPEDYVTDRSQRFMASEIIREKLMRFTGEELPYSVTVEIEQFKVN-ERGTYEINGLILVEREG 243 Haemophilus influenza...
P06616 163 DTIAAIVRKHLPEATHHFPEDYITDRSQRFMASEIIREKLMRFLGAELPYSVTVEIERFVSN-ERGGYDINGLILVEREG 241 Escherichia coli K-12
P42182 162 ETLLAQIEAYLPEGPQFYPSDQVTDHPERFIISELIREKVLHLTREEIPHSIAVAIESIKGQ-DNGSVHVAATIVVERDS 240 Bacillus subtilis sub...
Q55526 178 SNFQSALEARLDPGPYYYPPDLVTDQPERFIMAELIREQILLLTRQEVPHSVAIAIEKVEET-PER-TNVFAAITVERGS 255 Synechocystis sp. PCC...
O51604 157 EELKNKIYENFSEGPLYYPQEYYTDQEINFRISEIIREKAIEnLKEELPY--SLYVDIDTLEnKKGSLFIRANIFVANES 234 Borrelia burgdorferi B31
P47627 158 LFWSIFKQVELRYNIFRKDINFIDANNDDFKILEGLREQIIFYCKNEIPHIARIEIIEKSFNkEKNLLKIHLVISVPKLS 237 Mycoplasma genitalium...
P75210 158 SFWNQFNEVKLQANEFRKDVEFLDADTDNFKILEALREQIIKYCSEEIPHVVRLEIVDKSFDqAKNLLKLHLSISVPKLS 237 Mycoplasma pneumoniae...
1EGA_A 242 QKKMVIGNKGAKIKTIGIEARKDMQEMFEAPVHLELWVK 280 Escherichia coli BW2952
P43728 244 QKKMVIGAGGQKIKTIGMEARADMERLFDNKVHLELWVK 282 Haemophilus influenzae Rd KW20
P06616 242 QKKMVIGNKGAKIKTIGIEARKDMQEMFEAPVHLELWVK 280 Escherichia coli K-12
P42182 241 QKGIVIGKKGSLLKEVGKRARADIEALLGSRVYLELWVK 279 Bacillus subtilis subsp. subtilis str. 168
Q55526 256 QKGIIIGQKGSMLQAIGTAARQQIQKLISGDVYLKLFVK 294 Synechocystis sp. PCC 6803 substr. Kazusa
O51604 235 QKGIIVGKNGKEIKSIGERARKTIAKIFETKCNLFLQVK 273 Borrelia burgdorferi B31
P47627 238 QKKIIIGKNAEMIKAIGIATRKKLLNHFDCDIFIDIFVK 276 Mycoplasma genitalium G37
P75210 238 QKKIIIGRNAQMVKKIGMQMRQKLLEYYDCNVFVELFVR 276 Mycoplasma pneumoniae M129
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap