2OQ2


Conserved Protein Domain Family
cysH

?
TIGR00434: cysH 
Click on image for an interactive view with Cn3D
phosophoadenylyl-sulfate reductase (thioredoxin)
This enzyme, involved in the assimilation of inorganic sulfate, is designated cysH in Bacteria and MET16 in Saccharomyces cerevisiae. Synonyms include phosphoadenosine phosphosulfate reductase, PAPS reductase, and PAPS reductase, thioredoxin-dependent. In a reaction requiring reduced thioredoxin and NADPH, it converts 3(prime)-phosphoadenylylsulfate (PAPS) to sulfite and adenosine 3(prime),5(prime) diphosphate (PAP). A related family of plant enzymes, scoring below the trusted cutoff, differs in having a thioredoxin-like C-terminal domain, not requiring thioredoxin, and in having a preference for 5(prime)-adenylylsulfate (APS) over PAPS. [Central intermediary metabolism, Sulfur metabolism]
Statistics
?
PSSM-Id: 129526
View PSSM: TIGR00434
Aligned: 6 rows
Threshold Bit Score: 337.53
Threshold Setting Gi: 165760900
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2OQ2_A        30 PQEIIAWSIVTFP-HLFQTTAFGLTGLVTIDMLSKLSEKYYMPellFID---TLHHFPQTLTLKNEIEKKYYqpknQTIH 105 baker's yeast
P72794        22 AQQIITWAAQTFGpGLVMSTSFGIQAAVMLHLVTSIVPNIPVI---WID---TGYLPLETYQFADQLTGRLQ----LNLK 91  Synechocystis s...
P94498        23 ALSVLKWAYGHYGdQLVYACSFGIEGIVLIDLIYKVKKDAEIV---FLD---TGLHFKETYETIERVKERYPg---LNII 93  Bacillus subtil...
WP_015715655  25 eLDVLKWAYRTYGeKIVYACSFGAEGMVLLDLISKINKNAHII---FLD---TGLHFQETYELIETVKERYPg---FAIQ 95  Bacillus subtilis
WP_001316587  84 AEGRVAWALDNLPgEYVLSSSFGIQAAVSLHLVNQIRPDIPVI---LTD---TGYLFPETYRFIDELTDKLK----LNLK 153 Escherichia coli
P18408        30 PQEIIAWSIVTFP-HLFQTTAFGLTGLVTIDMLSKLSEKYYMP---ELLfidTLHHFPQTLTLKNEIEKKYYqpknQTIH 105 Saccharomyces c...
2OQ2_A       106 VYKPDgcESEADFASKYGdFLWEK----DDDKYDYLAKVEPAHRAYKELHISAVFTGRRKSQGSARSQLSIIEIDElnGI 181 baker's yeast
P72794        92 VYQSP--LSPARMEALYG-KLWQQkdveSLNRYDQIRKVEPMQRALKELEAIAWLTGLRRDQTRHRQNLKPVDLQG--NQ 166 Synechocystis s...
P94498        94 LKKPD--LTLEEQAEEHGdKLWERe----PNQCCYLRKVVPLREALSGHP--AWLSGLRRDQGPSRANTNFLNKDEkfKS 165 Bacillus subtil...
WP_015715655  96 MLEPE--LSLTEQGTKYGgELWKH----NPNLCCQLRKIEPLKKHLSGMT--AWISGLRRDQSPTRKHIQYVNLDQkfEL 167 Bacillus subtilis
WP_001316587 154 VYRAT--ESAAWQEARYG-KLWEQgv-eGIEKYNDINKVEPMNRALKELNAQTWFAGLRREQSGSRANLPVLAIQR--GV 227 Escherichia coli
P18408       106 VYKPDgcESEADFASKYGdFLWEK----DDDKYDYLAKVEPAHRAYKELHISAVFTGRRKSQGSARSQLSIIEIDElnGI 181 Saccharomyces c...
2OQ2_A       182 LKINPLINWTFEQVKQYIDANNVPYNELLDLGYRSIGDYHSTQPVKEG-EDERAGRWKGkAKTECGIHE 249 baker's yeast
P72794       167 YKVLPILDWNSKMVYEYLTAHDLPYHPFFDQGYVSVGDWHSSRPLMAHdEDERDTRFHG-LKQECGLHL 234 Synechocystis sp. PCC 6803...
P94498       166 VKVCPLIHWTWKDIWRYTSRNELDYNPLHDQGYPSIGCAPCTSPAFTA-EDLRSGRWNGmAKTECGLHE 233 Bacillus subtilis subsp. s...
WP_015715655 168 IKICPLIHWTWDDVWTYIRLHNLPYNKLHDQHYPSIGCEMCTLPSPDP-NDERAGRWAGrEKTECGLHQ 235 Bacillus subtilis
WP_001316587 228 FKVLPIIDWDNRTIYQYLQKHGLKYHPLWDEGYLSVGDTHTTRKWEPG-MAEEETRFFG-LKRECGLHE 294 Escherichia coli
P18408       182 LKINPLINWTFEQVKQYIDANNVPYNELLDLGYRSIGDYHSTQPVKEG-EDERAGRWKGkAKTECGIHE 249 Saccharomyces cerevisiae S...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap