1K8W


Conserved Protein Domain Family
TruB

?
TIGR00431: TruB 
Click on image for an interactive view with Cn3D
tRNA pseudouridine(55) synthase
TruB, the tRNA pseudouridine 55 synthase, converts uracil to pseudouridine in the T loop of most tRNAs in all three domains of life. This model is built on a seed alignment of bacterial proteins only. Saccharomyces cerevisiae protein YNL292w (Pus4) has been shown to be the pseudouridine 55 synthase of both cytosolic and mitochondrial compartments, active at no other position on tRNA and the only enzyme active at that position in the species. A distinct yeast protein YLR175w, (centromere/microtubule-binding protein CBF5) is an rRNA pseudouridine synthase, and the archaeal set is much more similar to CBF5 than to Pus4. It is unclear whether the archaeal proteins found by this model are tRNA pseudouridine 55 synthases like TruB, rRNA pseudouridine synthases like CBF5, or (as suggested by the absence of paralogs in the Archaea) both. CBF5 likely has additional, eukaryotic-specific functions. The trusted cutoff is set above the scores for the archaeal homologs of unknown function, so yeast Pus4p scores between trusted and noise. [Protein synthesis, tRNA and rRNA base modification]
Statistics
?
PSSM-Id: 129523
View PSSM: TIGR00431
Aligned: 8 rows
Threshold Bit Score: 308.144
Threshold Setting Gi: 6136050
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1K8W_A  24 INGVLLLDKPQGMSSNDALQKVKRIYNANRAGHTGALDPLATGMLPICLG-EATKFSQYLLDSDKRYRVIARLGQRTDTS 102 Escherichia coli
O84096   8 IEGVLLVDKPQGRTSFSLIRSLVRLIGVKKIGHAGTLDPFATGVMVMLIGrKFTRLSDIMLFEDKEYAAVAHLGTTTDTY 87  Chlamydia trachomatis...
P09171  11 INGVLLLDKPQGMSSNDALQKVKRIYNANRAGHTGALDPLATGMLPICLG-EATKFSQYLLDSDKRYRVIARLGQRTDTS 89  Escherichia coli
P45142  11 VDGVFLLDKPQGMSSNDIMQKVKRLFQANKAGHTGALDPLATGMLPICLG-EATKFSQFLLDADKRYLVTAKLGERTDTS 89  Haemophilus influenza...
P74696   1 MFGFLNLHKPLHLTSHDCVAKVRRLLRQKRVGHGGTLDPLAEGVLPLAVG-SATRLLPYLP-GAKQYQALIRFGVRTDSD 78  Synechocystis sp. PCC...
O51743   2 ENGFLLINKEQGKTSFETLFPIKKYFNTNRVGHAGTLDKFASGILVCLVG-KYTKLSGYFTSLDKEYVAEFRFGLETDTL 80  Borrelia burgdorferi B31
O83859   7 PDAIVPFAKVSGLTSFAALAQVRRLLGVKKVGHTGTLDRFADGLLLLLVG-GFTKLAPVMTRLEKSYEARIQFGVQTDTL 85  Treponema pallidum su...
P32732   2 VNGVLLLHKPVGMTSHDCVMKIRKLLKTKKVGHTGTLDPEVSGVLPICVG-RATKIVEYLTEKSKTYDAEITLGFSTTTE 80  Bacillus subtilis sub...
1K8W_A 103 DADGQIVEERPVTFSAE--QLAAALDTFRGDIEQIPSMYSALKYQGKKLYEYARQGIEVPREARPITVYeLLFI------ 174 Escherichia coli
O84096  88 DCDGKIVGRSKKVPTMD--EVLTCTSYFQGEIQQVPPMFSAKKVQGKKLYEYARQGLSIERRFATVTVN-LRLV------ 158 Chlamydia trachomatis...
P09171  90 DADGQIVEERPVTFSAE--QLAAALDTFRGDIEQIPSMYSALKYQGKKLYEYARQGIEVPREARPITVYeLLFI------ 161 Escherichia coli
P45142  90 DAEGQVVETREVNLETQ--QILTALEQFRGDILQVPTMFSALKHNGKPLYEYARQGITVEREARPITIFeLNFI------ 161 Haemophilus influenza...
P74696  79 DLAGEVLESKNVSYLTLa-AVEQILPTFLGEIEQIPPQYSAIQVNGKRLYELARAGIPQAVPSRMVTINdLKILgw---- 153 Synechocystis sp. PCC...
O51743  81 DPNGRIVSKTDYIPNVE--DIDLKLKDFVGEIYQSPPRFSSVHIDGSRAYKLALNGKFFEIKKRKVTVYnIQRLs----- 153 Borrelia burgdorferi B31
O83859  86 DPEGAVVR-CSLFPTFA--RVRAALPHFTGSIDQVPPEYSALKFGGVRASDRVRRGEAVCMKARRVFVFdLQVLgceadl 162 Treponema pallidum su...
P32732  81 DQTGETVETKPVNHDIDkaDVEKVLNSLKGKQEQIPPMYSAVKVNGKKLYEYARAGIEVERPKRMITIEdIALTte---- 156 Bacillus subtilis sub...
1K8W_A 175 ---RHEGN---------------ELELEIHCSKGTYIRTIIDDLGEKLGCGAHVIYLRRLAVSKYPVERMVTLEHL 232 Escherichia coli
O84096 159 ---KYEYP---------------RLHFVVQCSKGTYIRSIAHELGNMLGCGAYLEELRRLRSGSFSIDQCIDGNLL 216 Chlamydia trachomatis D/U...
P09171 162 ---RHEGN---------------ELELEIHCSKGTYIRTIIDDLGEKLGCGAHVIYLRRLAVSKYPVERMVTLEHL 219 Escherichia coli
P45142 162 ---EYNAP---------------FLTLEVHCSKGTYIRTLVDDLGEVLGCGAHVTMLRRTAVADYPVAEMMPINEL 219 Haemophilus influenzae Rd...
P74696 154 --rSGNQP---------------ELDLQVTCGEGTYIRALARDLGDRLGTGATLAGLVRQQSGGMALDNSVGLTAL 212 Synechocystis sp. PCC 680...
O51743 154 ----YDFSs-------------sLLSLKISCSKGTYIRSIARDLAYSLNSCAYVSNLKRTKVGMFRLKDSTLCENL 212 Borrelia burgdorferi B31
O83859 163 gefKKTQAgrgaaiadldltrvrAVTLYVRCSAGFYVRALARDIAAACGSCAYVSHLRRTRIGPFDLAQAAGVSRL 238 Treponema pallidum subsp....
P32732 157 --iKHHGEt-------------aSFRFTVTCSKGTYVRTLAVMIGEKLGYPAHMSHLIRTASGDFSLDECFTFDEL 217 Bacillus subtilis subsp. ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap