Conserved Protein Domain Family
Q_tRNA_tgt

?
TIGR00430: Q_tRNA_tgt 
tRNA-guanine transglycosylase
This tRNA-guanine transglycosylase (tgt) catalyzes an exchange for the guanine base at position 34 of many tRNAs; this nucleotide is subsequently modified to queuosine. The Archaea have a closely related enzyme that catalyzes a base exchange for guanine at position 15 in some tRNAs, a site that is subsequently converted to the archaeal-specific modified base archaeosine (7-formamidino-7-deazaguanosine), while Archaeoglobus fulgidus has both enzymes. [Protein synthesis, tRNA and rRNA base modification]
Statistics
?
PSSM-Id: 129522
View PSSM: TIGR00430
Aligned: 7 rows
Threshold Bit Score: 597.087
Threshold Setting Gi: 3122931
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O51749   2 FSVIKNDKHfnARVGFLNLPHG----RVDIPCFMPVGTLGAMKGLKHAVLEKLE-CNLMLANTYHLYLRLGIKTVEKYVG 76  Borrelia burgdorferi B31
P19675   3 FELDTTDGR--ARRGRLVFDRG----VVETPCFMPVGTYGTVKGMTPEEVEATG-AQIILGNTFHLWLRPGQEIMKLHGD 75  Escherichia coli
P44594   3 YELDKTSGN--ARRGRLVFERPqgtfSVETPAFMPVGTYGTVKGMTPEEVRATG-AEILLGNTFHLWLRPGQEVMRKHGD 79  Haemophilus influenza...
O32053   8 YEFIKECKQtgARLGKVHTPHG----SFETPVFMPVGTLATVKTMSPEELKAMD-AGIILSNTYHLWLRPGQDIVKEAGG 82  Bacillus subtilis sub...
O28787   5 FRIKHTLDR--MRVGKVKTRHG----SFETPVFIPVATLAAIRGLDNRDLKDMG-VEVILANTYHLHLRPGDELIKELGG 77  Archaeoglobus fulgidu...
Q55983  10 YQCQARCSHsqARAGIFQTPHG----PVETPRFMPVGTLATVKGITPAQLADTQ-AQMVLANTYHLHLQPGEKIIAAAGG 84  Synechocystis sp. PCC...
O08314   3 FQLQATDNN--ARAGLLNLAHS----QVATPVFMPVGTQGCIKSLDATDAQEILgAKLILANTYHMYLRPGEKVVEELGG 76  Helicobacter pylori 2...
O51749  77 LHNFTIWNKNFLTDSGGFRVFSFS----------------------DLRKIDLK----------GVHFKSHIDGSYHYFT 124 Borrelia burgdorferi B31
P19675  76 LHDFMQWKGPILTDSGGFQVFSLG----------------------DIRKITEQ----------GVHFRNPINGDPIFLD 123 Escherichia coli
P44594  80 LHDFMQWHRPILTDSGGFQVFSLG----------------------KLRKITEE----------GVKFQNPINGERIFLS 127 Haemophilus influenza...
O32053  83 LHKFMNWDRAILTDSGGFQVFSLS----------------------KFRNIEEE----------GVHFRNHLNGDKLFLS 130 Bacillus subtilis sub...
O28787  78 LHKFMNFDGVIVTDSGGFQAFSLGfgmehgvgkiannifleelreeRLREAENErkklavvtdrGVRFKDPKSGRIVELT 157 Archaeoglobus fulgidu...
Q55983  85 VHKFMGWSGPMLTDSGGFQVFSLS----------------------QLRTIGEQ----------GVLFRSPRDGRLIDMT 132 Synechocystis sp. PCC...
O08314  77 LHRFAQFYGSFLTDSGGFQAFSLS----------------------DNVKLQED----------GIVFKSHIDGSKHLFT 124 Helicobacter pylori 2...
O51749 125 SEGIFAMQEIFGSDIIMPLDICSSYGIDYNEANLYTNITTNWASSTFKSSKNRKegYNGLLFLITQGNFFKDLRKRSIND 204 Borrelia burgdorferi B31
P19675 124 PEKSMEIQYDLGSDIVMIFDECTPYPADWDYAKRSMEMSLRWAKRSRERFDSLG--NKNALFGIIQGSVYEDLRDISVKG 201 Escherichia coli
P44594 128 PEKSMEIQYDLGSDIVMIFDECTPYPATFDYAKKSMEMSLRWAKRSRDRFDELG--NKNALFGIIQGGVFEELRKVSLEG 205 Haemophilus influenza...
O32053 131 PEKAMEIQNALGSDIMMAFDECPPYPAEYDYMKRSVERTSRWAERCLNAHNRQ---DEQGLFGIVQGGEYEDLRTQSAKD 207 Bacillus subtilis sub...
O28787 158 PKKSMEIQSNLGSDIIFAFDECTSPLSDRDYTEKALERTHRWAEECLQHYDRR-----QALFGVVQGGEYRDLREKSARF 232 Archaeoglobus fulgidu...
Q55983 133 PENSIRIQNALGADVIMAFDECPPGQGDRLMVEQATARTYRWLERCIEAHQRP---GDQALFGIVQGGTYLDLRSQAAEQ 209 Synechocystis sp. PCC...
O08314 125 PAKVLDIQYSLNSDIMMVLDDLVGLPAPLKRLEESIKRSAKWANMSLEYHKEKNr-PSNNLFAIIQGGTHLKMRSL-SVG 202 Helicobacter pylori 2...
O51749 205 ILELDSPGIAIGGiSVGEPREKYLEILEYSFLLIPKEKPRYVMGIGTPHYILNAIYYGIDIFDCFNPARITRHGSLLTD- 283 Borrelia burgdorferi B31
P19675 202 LVDIGFDGYAVGGlAVGEPKADMHRILEHVCPQIPADKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVT- 280 Escherichia coli
P44594 206 LVNIGFDGYAVGGlAVGEPKEDMHRILEYICPQIPADKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVT- 284 Haemophilus influenza...
O32053 208 LISLDFPGYAIGGlSVGEPKDVMNRVLEFTTPLLPKDKPRYLMGVGSPDALIDGAIRGVDMFDCVLPTRIARNGTVFTA- 286 Bacillus subtilis sub...
O28787 233 MAERDFAGYGIGG-SLGKSKQDMLNILDWVIPLLPEEKPRHLLGIGAIEDLFNCTEKGVDMYDCVAPARWARRGHLYVSp 311 Archaeoglobus fulgidu...
Q55983 210 LIALDLPGYAIGGvSVGEAPALIDKVVQHTAPLLPAHKPRYLMGVGTYREMARAIFAGIDLFDCVIPTRFGRHGTALVQ- 288 Synechocystis sp. PCC...
O08314 203 LTHEGFDGYAIGGlAVGESADEMLETIAHTAPLLPKDKPRYLMGVGTPENILDAISLGVDMFDCVMPTRNARNATLFTH- 281 Helicobacter pylori 2...
O51749 284 -NG-------IMCIGRKEYKDDTSKVEKNCICTLCKRYSRGYLRHLIKSKELFGIVLASEHNIHYMFRLISKIRAAILND 355 Borrelia burgdorferi B31
P19675 281 -DG-------VVKIRNAKYKSDTGPLDPECDCYTCRNYSRAYLHHLDRCNEILGARLNTIHNLRYYQRLMAGLRKAIEEG 352 Escherichia coli
P44594 285 -DG-------IVKIRNAKYRDDTSPLDPECDCYTCKNYTKAYLYHLDKCGEILGARLNTIHNLRYYQRLMAEIRQAIEDD 356 Haemophilus influenza...
O32053 287 -EG-------RLNMKNAKFERDFRPIDEECDCYTCKNYTRAYIRHLIRCNETFGLRLTTYHNLHFLLHLMEQVRQAIRED 358 Bacillus subtilis sub...
O28787 312 aEGgnvrnkfRIHIKNAAFRIDNRPVDRTCDCLVCQNYSRAYLRHLYKANELLYFRLATYHNIYFVVKLMERIRESIADG 391 Archaeoglobus fulgidu...
Q55983 289 -GE-------RWNLKNATFREDHRPLDETCPCYTCQTFSRAYLNHLIRSREMLGYILLSLHNITELIRFTQSIRQAILND 360 Synechocystis sp. PCC...
O08314 282 -SG-------KISIKNAPYKLDNTPIEENCACYACKRYSKAYLHHLFRAKELTYARLASLHNLHFYLELVKNARNAILEK 353 Helicobacter pylori 2...
O51749 356 DFLNFRTSYLKKYEEENF 373 Borrelia burgdorferi B31
P19675 353 KLESFVTDFYQRQGREVP 370 Escherichia coli
P44594 357 RFDDFVVEFYARMGKPVP 374 Haemophilus influenzae Rd KW20
O32053 359 RLGDFREEFFERYGYNKP 376 Bacillus subtilis subsp. subtilis str. 168
O28787 392 ---SFYELKREWLGF--- 403 Archaeoglobus fulgidus DSM 4304
Q55983 361 ---TFTQDFAH---WLTP 372 Synechocystis sp. PCC 6803 substr. Kazusa
O08314 354 RFLSFKKEFLEKYNSRSH 371 Helicobacter pylori 26695
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap