Conserved Protein Domain Family
TIGR00427

?
TIGR00427: TIGR00427 
membrane protein, MarC family
MarC is a protein that spans the plasma membrane multiple times and once was thought to be a multiple antibiotic resistance protein. The function for this family is unknown. [Unknown function, General]
Statistics
?
PSSM-Id: 129521
View PSSM: TIGR00427
Aligned: 5 rows
Threshold Bit Score: 219.197
Threshold Setting Gi: 3025198
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P25743   2 IQTffdFPVYFKFFIGLFALVNPVGIIPVFISMTSYQTAAARNKTNLTANLSVAIILWISLFLGDTILQLFGISIDSFRI 81  Escherichia coli K-12
O28169   1 MDIagyLSFFFASFTTLFIIIDPPGNLPIFIALTERFSDEYREKISKRATIIAFLILFITMVTGGKILDYFGVSISSLKI 80  Archaeoglobus fulgidu...
Q59071   1 MD----LQYFILAFSSIFSILNPFGAVPVFITLTESYPKKERDLVAKKTVIYALAILLAFALFGEWILKFFGISLDAFKI 76  Methanocaldococcus ja...
Q58382  17 MDI---LNFYIYGFVSLFITIDPIGLIPIVHSLTYPYPKEQRIRIIKKAIISSTVVLLLFALFGNYIFGYFGITIDAFRV 93  Methanocaldococcus ja...
O32244   1 MM----FSFIVHVFISLFAVSNPIGNVPIFLTLTEGYTAAERKAIARKAAILSFFILAAFLVFGHLIFKLFDINIHALRV 76  Bacillus subtilis sub...
P25743  82 AGGILVVTIAMSMISGkLGEDKQNK-QEKSETAVRESIGVVPLALPLMAGPGAISSTIVWGTRYHSISYLFGFFVAIALF 160 Escherichia coli K-12
O28169  81 AGGILLFISSVDILLG-GTRREAYK-RRAEESIDVDSIAVFPLALPLYTGPGAITAGIVLYSQAGDVVMKLLVVLSAALV 158 Archaeoglobus fulgidu...
Q59071  77 AGGILLLLISLDMVRG-QQEAKIHR-KEIEAAYEIDEIALMPLATPLLAGPGSITACMVAMAEASDIGDKFLVILAILLS 154 Methanocaldococcus ja...
Q58382  94 AGGILLFKIAWDMLHA-EIPKTKHKpDERLDLEDIDSIVYVPLAIPLISGPGAITTTMILISKTQSILEKGVVVLSILSA 172 Methanocaldococcus ja...
O32244  77 AGGIFIFGIAYNLLNAkESHVQSLHhDEHKESKEKADISVTPLSIPIIAGPGTIATVMSLSAGHSGIGHYAAVMIGIAAV 156 Bacillus subtilis sub...
P25743 161 ALCCWGLFRMAPWLVRVLRQTGINVITRIMGLLLMALGIEFIVTGI 206 Escherichia coli K-12
O28169 159 YSIVRLSHIYSAPIIRLLGRSGADIAARILAIFLAAIAVEFVFDGL 204 Archaeoglobus fulgidus DSM 4304
Q59071 155 LGITYLTLLSAESVLDRIGRLGIRILTRMMGLILTAIAVQMIVNGI 200 Methanocaldococcus jannaschii DSM 2661
Q58382 173 MLVSGIILSLTDFIIRRVNIYGINAFVRIMGLLLVAISVQIIFTGI 218 Methanocaldococcus jannaschii DSM 2661
O32244 157 IALTFLFFHYSAFISSKLGKTEMNVITRLMGLILAVVAVGMIGAGL 202 Bacillus subtilis subsp. subtilis str. 168
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap