Conserved Protein Domain Family
ubiX_pad

?
TIGR00421: ubiX_pad 
UbiX family flavin prenyltransferase
UbiX partners with UbiD for decarboxylation of the 3-octaprenyl-4-hydroxybenzoate precursor during ubiquinone biosynthesis, but the role of UbiX is as a flavin prenyltransferase that provides a cofactor UbiD requires.In E.coli, the protein UbiX (3-octaprenyl-4-hydroxybenzoate carboxy-lyase) has been shown to be involved in the third step of ubiquinone biosynthesis, the reaction [3-octaprenyl-4-hydroxybenzoate = 2-octaprenylphenol + CO2]. The knockout of the homologous protein in yeast confers sensitivity to phenylacrylic acid. Members are not restricted to ubiquinone-synthesizing species. This family represents a distinct clade within the flavoprotein family of pfam02441.
Statistics
?
PSSM-Id: 129515
View PSSM: TIGR00421
Aligned: 5 rows
Threshold Bit Score: 307.096
Threshold Setting Gi: 13124399
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O26250   6 MIILAMTGASGVIYGERILKALRGAgVRIGLMITDTAREIIRYELGIEPGALEELADECFDASDFTTSINSGSSPFRAMV 85  Methanothermobacter t...
Q57566   2 KIIVCITGASGVIYAKRLLEVLKDR-AEVNLIISNSAKKIIKEELDIDWKEIKKLATDYYENDDFFSPLASGSNKFDAVV 80  Methanocaldococcus ja...
O29054   2 RFVVALTGASGQILGIRLIEKLTELgAEVYAVASRAAKITLKAETDYDEGYVREIATKYYDEDEIAAPFASGSFRHDGMA 81  Archaeoglobus fulgidu...
P33751  56 RIVVAITGATGVALGIRLLQVLKELsVETHLVISKWGAATMKYETDWEPHDVAALATKTYSVRDVSACISSGSFQHDGMI 135 Saccharomyces cerevis...
P94404  14 KLVVGMTGATGAIFGVRLLQWLKAAgVETHLVVSPWANVTIKHETGYTLQEVEQLATYTYSHKDQAAAISSGSFDTDGMI 93  Bacillus subtilis sub...
O26250  86 IAPCTMKTLSAIANGYAENSLTRAADVCLKERRDLVLVPRETPLRSVHLENMLRVSREGGIILPAMPGFYHKPASIEDMA 165 Methanothermobacter t...
Q57566  81 VVPCSMKTLSAIANGYSANLIVRVCDIALKERRKLIIMPREMPFNSIHLENMLKLSNLGAIVMPPIPAFYNKPKNVNDII 160 Methanocaldococcus ja...
O29054  82 VVPCSIKTASSIAYGIADNLIARAADVTLKEKRRLVLAIREAPLHSGHLKTLARLAEMGAVIFPPVLSFYTRPKSVDDLI 161 Archaeoglobus fulgidu...
P33751 136 VVPCSMKSLAAIRIGFTEDLITRAADVSIKENRKLLLVTRETPLSSIHLENMLSLCRAGVIIFPPVPAFYTRPKSLHDLL 215 Saccharomyces cerevis...
P94404  94 VAPCSMKSLASIRTGMADNLLTRAADVMLKERKKLVLLTRETPLNQIHLENMLALTKMGTIILPPMPAFYNRPRSLEEMV 173 Bacillus subtilis sub...
O26250 166 DFIAGKVLDVLGIENDLFRRW 186 Methanothermobacter thermautotrophicus str. Delta H
Q57566 161 NFVVGRVLDILGIDNSLFKRW 181 Methanocaldococcus jannaschii DSM 2661
O29054 162 EHTVSRIAEQLGVEVDY-RRW 181 Archaeoglobus fulgidus DSM 4304
P33751 216 EQSVGRILDCFGIHADTFPRW 236 Saccharomyces cerevisiae S288c
P94404 174 DHIVFRTLDQFGIRLPEAKRW 194 Bacillus subtilis subsp. subtilis str. 168
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap