Conserved Protein Domain Family
serS_MJ

?
TIGR00415: serS_MJ 
seryl-tRNA synthetase, Methanococcus jannaschii family
The seryl-tRNA synthetases from a few of the Archaea, represented by this model, are very different from the set of mutually more closely related seryl-tRNA synthetases from Eubacteria, Eukaryotes, and other Archaea. Although distantly homologous, the present set differs enough not to be recognized by the pfam model tRNA-synt_2b that recognizes the remainder of seryl-tRNA synthetases among oither class II amino-acyl tRNA synthetases. [Protein synthesis, tRNA aminoacylation]
Statistics
?
PSSM-Id: 129509
View PSSM: TIGR00415
Aligned: 2 rows
Threshold Bit Score: 962.873
Threshold Setting Gi: 3122916
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q58477   3 LTFDLDGKIIFSKELSEEAKNAVEEVLKNADSIFLKGVPKGKENEASKIKSYEFEGNILKLKIASGTYTRAHEGLIRLRK 82  Methanocaldococcus ja...
O27194   1 MKFKLKGIIKLSKEVPGIEDDLEKFFTEAESDILRRGVPEGQEHEAAHIKSWRLEGDTLHIEMESGRRVRAHDGLLRLKK 80  Methanothermobacter t...
Q58477  83 PLAEKLGRNFRIGVRGIEIDNYVITIETD-EDKAKKLEGIKVPECEAKVEGnKIILTFKDIGESELKRNIIDRAIKFVKT 161 Methanocaldococcus ja...
O27194  81 PLGQLLGPKYRVGVRGISVTDYTMEMKAPgVSGIPSLAELPFVEDAAITDG-TIMVRFQPLEESDLRKHVFDRVVKHART 159 Methanothermobacter t...
Q58477 162 ELEKEEeDLTFKVCKIPPGTIVSEYKAkRKITFDKDPTDVAEKLGWVKKFPGRGQWFYTPPITALFRALEELIVEEVVKK 241 Methanocaldococcus ja...
O27194 160 LVESSD-DLTVQVTRATPGEIIARSRS-RDFFFEGDPTEEAMRLGWVKKFPGRGQWFYGPKITALHRALEEFFIERIVKP 237 Methanothermobacter t...
Q58477 242 IGFQECLFPKLIPLEIMYKMRYLEGLPEGMYYVCPPKREPELFKEFVNEMMIKKEIPIEKLKNLLRDPGYVLAPAQCEPF 321 Methanocaldococcus ja...
O27194 238 LGFVECLFPKLIPLDIMNKMRYLEGLPEGMYYCSAPSRDPETFEEFKNELIINREVPMDLLKRGIKDPGYVIAPAQCEPF 317 Methanothermobacter t...
Q58477 322 YQFFEGEVID-VDKPIMFFDRSGWTYRWEGGGARGLDRVNEFLRVECVWIGSPEFVEETRDKTLKYAEKLAEKLDLEYWV 400 Methanocaldococcus ja...
O27194 318 YQFLSHEVVSaEDLPVKFFDRSGWTYRWEAGGSKGLDRVHEFQRVELVWLAEPGETEEIRDRTVELSHDAADELELEWYT 397 Methanothermobacter t...
Q58477 401 EVGDDPFYLEGRKKEDRGIEFPDVPKYEMRLWLPHIKderKGVAVTSANVHGTHFVEGFRIKDYKGRRVWTGCTGYGITR 480 Methanocaldococcus ja...
O27194 398 EVGDDPFYLEGRKVEERGIEFPDVPKYEMRLSLPGRE---KGVAVVSANVHGTHFIEGFSIREARNLNIWTGCTGIGLSR 474 Methanothermobacter t...
Q58477 481 WVVGYLAQYGFNFDDWHPIIKKKIKKLpEVPQLITWPKKD 520 Methanocaldococcus jannaschii DSM 2661
O27194 475 WIYGFLAQKGFETGNWPDFIGERVEGV-ENPRIITWPRQD 513 Methanothermobacter thermautotrophicus str. Delta H
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap