1NHO,1FO5


Conserved Protein Domain Family
redox_disulf_1

?
TIGR00411: redox_disulf_1 
Click on image for an interactive view with Cn3D
small redox-active disulfide protein 1
This protein is homologous to a family of proteins that includes thioredoxins, glutaredoxins, protein-disulfide isomerases, and others, some of which have several such domains. The sequence of this protein at the redox-active disufide site, CPYC, matches glutaredoxins rather than thioredoxins, although its overall sequence seems closer to thioredoxins. It is suggested to be a ribonucleotide-reducing system component distinct from thioredoxin or glutaredoxin. [Unknown function, General]
Statistics
?
PSSM-Id: 129505
View PSSM: TIGR00411
Aligned: 4 rows
Threshold Bit Score: 124.224
Threshold Setting Gi: 2501199
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1NHO_A  3 VNIEVFTSPTCPYCPMAIEVVDEAKKEFGDKIDVEKIDIMVDREKAIEYGLMAVPAIAINGVVRFVGAPSREELFEAIND 82  Methanothermobacter th...
O28137  2 VMMKLFTSPTCPYCPKAEKVVSKVAKEEGVLAINLPVNTDEGLKEALKFGIRGVPALVINDKYLILGVPDEGELRQLIRK 81  Archaeoglobus fulgidus...
Q57755  4 VKIELFTSPMCPHCPAAKRVVEEVANEMPDAVEVEYINVMENPQKAMEYGIMAVPTIVINGDVEFIGAPTKEALVEAIKK 83  Methanocaldococcus jan...
1FO5_A  4 VKIELFTSPMCPHCPAAKRVVEEVANEMPDAVEVEYINVMENPQKAMEYGIMAVPTIVINGDVEFIGAPTKEALVEAIKK 83  Methanocaldococcus jan...
1NHO_A 83 EM 84  Methanothermobacter thermautotrophicus str. Delta H
O28137 82 LK 83  Archaeoglobus fulgidus DSM 4304
Q57755 84 RL 85  Methanocaldococcus jannaschii DSM 2661
1FO5_A 84 RL 85  Methanocaldococcus jannaschii DSM 2661
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap