1VLU


Conserved Protein Domain Family
proA

?
TIGR00407: proA 
Click on image for an interactive view with Cn3D
gamma-glutamyl phosphate reductase
The related model TIGR01092 describes a full-length fusion protein delta l-pyrroline-5-carboxylate synthetase that includes a gamma-glutamyl phosphate reductase region as described by this model. Alternate name: glutamate-5-semialdehyde dehydrogenase. The prosite motif begins at residue 332 of the seed alignment although not all of the members of the family exactly obey the motif. [Amino acid biosynthesis, Glutamate family]
Statistics
?
PSSM-Id: 161862
View PSSM: TIGR00407
Aligned: 6 rows
Threshold Bit Score: 611.791
Threshold Setting Gi: 52696231
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1VLU_A  23 ARKAGNILKTISNEGRSDILYKIHDALKANAHAIEEANKIDLAVAKETGLADSLLKRLDLFKGdKFEVXLQGIKDVAELE 102 baker's yeast
P07004   9 AKQASYKLAQLSSREKNRVLEKIADELEAQSEIILNANAQDVADARANGLSEAMLDRLALTPA-RLKGIADDVRQVCNLA 87  Escherichia coli K-12
P39821  11 AKEAAAEMIMKTTAEKDEALSLIANGLRKELDFLLAENAKDIVNGKENGLTPDIIDRLSLDEK-RIRDIADAVELLIDLA 89  Bacillus subtilis sub...
P54902  17 ARQAALHLGSLNTAERNQAIAAIADGLTAAMPEILAANQEDCAAAEAMGIAKPLYNRLLLGES-KLKSTIAGVKDVEHLP 95  Synechocystis sp. PCC...
P54885  11 ARKAGNILKTISNEGRSDILYKIHDALKANAHAIEEANKIDLAVAKETGLADSLLKRLDLFKGdKFEVMLQGIKDVAELE 90  Saccharomyces cerevis...
P45121   9 AKDAAFILAQLTTAEKNCALSIIAEQLEQQAPLILAENAKDIELAKQNGLSDALIDRLLLTQE-RLQGIANDVRHVISLA 87  Haemophilus influenza...
1VLU_A 103 DPVGKVKXARELDDGLTLYQVTAPVGVLLVIFESRPEVIANITALSIKSGNAAILKGGKESVNTFREXAKIVNDTIAQfq 182 baker's yeast
P07004  88 DPVGQVIDGGVLDSGLRLERRRVPLGVIGVIYEARPNVTVDVASLCLKTGNAVILRGGKETCRTNAATVAVIQDALKS-- 165 Escherichia coli K-12
P39821  90 DPIGDSLETIEKENGLFIEKIRVPLGVVGMIYEARPNVTVDAATLCLKTGNAVVLRGSSSAIHSNKALVSVIYRALEQ-- 167 Bacillus subtilis sub...
P54902  96 DPLGQVTLHRQLDEGLVLKRVGCPLGVLGVIFEARPEALIQISSLAIKSGNAVILKGGREATRSCQVLTEVIQTALAK-- 173 Synechocystis sp. PCC...
P54885  91 DPVGKVKMARELDDGLTLYQVTAPVGVLLVIFESRPEVIANITALSIKSGNAAILKGGKESVNTFREMAKIVNDTIAQfq 170 Saccharomyces cerevis...
P45121  88 DPVGKIIDGGTLDSGLKIERVRTPLGVIGTIYEARPNVTIDVASLCLKTGNAVILRGGKETQFSNKILIEVVQNALEQ-- 165 Haemophilus influenza...
1VLU_A 183 seTGVPVGSVQLIET--RQDVSDLLDQDEYIDLVVPRGSNALVRKIKDTTKIPVLGHADGICSIYLDEDADLIKAKRISL 260 baker's yeast
P07004 166 --CGLPAGAVQAIDNpdRALVSEMLRMDKYIDMLIPRGGAGLHKLCREQSTIPVITGGIGVCHIYVDESVEIAEALKVIV 243 Escherichia coli K-12
P39821 168 --SALPIHAVQLIEDtsRETAKELFTLNDGLDVLIPRGGKKLIDLVVRESTVPVLETGAGNCHIFIDETAKPQMAEKVVV 245 Bacillus subtilis sub...
P54902 174 --TVVSPEAINLLTT--REEIRELLGLNQYVDLIIPRGSNEFVQYIQQNTQIPVLGHADGICHLYLDAQADLSKAIPITV 249 Synechocystis sp. PCC...
P54885 171 seTGVPVGSVQLIET--RQDVSDLLDQDEYIDLVVPRGSNALVRKIKDTTKIPVLGHADGICSIYLDEDADLIKAKRISL 248 Saccharomyces cerevis...
P45121 166 --AGLPKFAVQAITDpnRELVMQLLKLDRYVDMIIPRGGSGLHELCKQHSTIPVIVGGVGVCHTFVEKSADQNKAIFVID 243 Haemophilus influenza...
1VLU_A 261 DAKTNYPAGCNAXETLLINPKFS-KWWEVLENLTLEGGVTIHA-----TkdlktAYFDKLNELGKLTEAIQCKTvdadee 334 baker's yeast
P07004 244 NAKTQRPSTCNTVETLLVNKNIAdSFLPALSKQMAESGVTLHA-----D-----AAALAQLQAGPAKVVAVKAE------ 307 Escherichia coli K-12
P39821 246 NAKTQRPSVCNAIESLLIHKAWArQHGKELLDQLENAGVEIRG-----D-----ELVCELHPSS---K-QASKE------ 305 Bacillus subtilis sub...
P54902 250 DAKTQYPAACNAIETLLVHQAIAaEFLPPLAQALGEKGVSLRG-----D-----SGTQKLIDCEPATEADWC-T------ 312 Synechocystis sp. PCC...
P54885 249 DAKTNYPAGCNAMETLLINPKFS-KWWEVLENLTLEGGVTIHAtkdlkT-----AYFDKLNELGKLTEAIQCKTvdadee 322 Saccharomyces cerevis...
P45121 244 NAKTQRPSTCNTLETLLVQHSIAeEFLPKLVSHLSAKNVKYHA-----K-----STALNILKQAGANVCEVTEK------ 307 Haemophilus influenza...
1VLU_A 335 qDFDKEFLSLDLAAKFVTSTESAIQHINTHSSRHTDAIVTENKANAEKFXKGVDSSGVYWNASTRFADGFRYGFGAEVGI 414 baker's yeast
P07004 308 -EYDDEFLSLDLNVKIVSDLDDAIAHIREHGTQHSDAILTRDMRNAQRFVNEVDSSAVYVNASTRFTDGGQFGLGAEVAV 386 Escherichia coli K-12
P39821 306 -DWETEFLAPVLSVKTVENVQEAVKHIQQYGTNHSEAILTENDKNAVYFQTAVDAAAVYHNASTRFTDGFEFGYGAEIGI 384 Bacillus subtilis sub...
P54902 313 -----EYSDLILSIKIVDSLEAAIDHINQYGSKHTDGIISEDLTAAEQFCQRVDSAGVYHNCSTRFADGFRYGFGAEVGI 387 Synechocystis sp. PCC...
P54885 323 qDFDKEFLSLDLAAKFVTSTESAIQHINTHSSRHTDAIVTENKANAEKFMKGVDSSGVYWNASTRFADGFRYGFGAEVGI 402 Saccharomyces cerevis...
P45121 308 -ELRKEWGSLDLNVVVVEDIHAAIEHIRQYGTQHSESILTSSQSLARQFINQVDAAAVYVNASTRFTDGGQFGLGAEVAV 386 Haemophilus influenza...
1VLU_A 415 STSKIHARGPVGLDGLVSYQ 434 baker's yeast
P07004 387 STQKLHARGPMGLEALTTYK 406 Escherichia coli K-12
P39821 385 STQKLHARGPMGLPALTSTK 404 Bacillus subtilis subsp. subtilis str. 168
P54902 388 STQKMPPRGPVGLEGLVTYK 407 Synechocystis sp. PCC 6803 substr. Kazusa
P54885 403 STSKIHARGPVGLDGLVSYQ 422 Saccharomyces cerevisiae S288c
P45121 387 STQKLHARGPMGLEALTSYK 406 Haemophilus influenzae Rd KW20
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap