Conserved Protein Domain Family
KOW_elon_Spt5

?
TIGR00405: KOW_elon_Spt5 
transcription elongation factor Spt5
This protein contains a KOW domain, shared by bacterial NusG and the uL24 (previously L24p/L26e) family of ribosomal proteins. The most recent papers and crystal structures make this a transcription elongation factor rather than a ribosomal protein.
Statistics
?
PSSM-Id: 129499
View PSSM: TIGR00405
Aligned: 3 rows
Threshold Bit Score: 213.214
Threshold Setting Gi: 499179745
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q57818         3 FAVRTMVGQEKNIAGLMASRAEKEQLDVYSILASESLKGYVLVEAETKGDVEELIKGMPRVRGIVP------GTIAIEEI 76  Methanocaldococ...
WP_010878044   5 FAVKTTANQERVVANLMDMAARKHNLKVYSILAPKELKGYIIVEAETPDDLLKAIRGLPHVKGVVK------GEISFSEI 78  Archaeoglobus f...
WP_010877285  19 YALKTSVGQEKNVARMLARKVRDSGIEINAILVPESLRGYILVESSSKIDMRNPAIRVPHLRGVVEsktegeAEIDFEEV 98  Methanothermoba...
Q57818        77 EPLLTPKKIIENIEKGDVVEIIAGPFKGERAKVIRVDKHKEEVTLELENAAVPIPITLPVEGVKIVSKHKD 147 Methanocaldococcus janna...
WP_010878044  79 EHFLTPKKAAEQIREGDKVEIVSGPFKGEMAIVKRVDEAKNEITVELLEAVVPIPVTVKADHVRVIDKKEE 149 Archaeoglobus fulgidus
WP_010877285  99 KRFLKPEPIISSIKKGSIVELISGPFKGERAKVIRIDESREEVVLELIEAAVPIPVTVKGDQIRIIQKEAD 169 Methanothermobacter ther...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap