Conserved Protein Domain Family
ndhI

?
TIGR00403: ndhI 
NADH-plastoquinone oxidoreductase subunit I protein
[Energy metabolism, Electron transport]
Statistics
?
PSSM-Id: 129498
View PSSM: TIGR00403
Aligned: 3 rows
Threshold Bit Score: 352.294
Threshold Setting Gi: 120536
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P26525      1 MFNnILKQVGDYAKESLQAAKYIGQGLAVTFDHMSRRPITVQYPYEKLIPSERFRGRIHFEFDKCIACEVCVRVCPINLP 80  Synechocystis sp. ...
P06253      1 MFS-IINGLKNYNQQAIQAARYIGQGFLVTLDHMNRLPTTIQYPYEKLIPSERFRGRIHFEFDKCIACEVCVRVCPINLP 79  liverwort
NP_039448   1 MFP-MVTGFMG--QQTIRAARYIGQSFIITLSHTNRLPITIHYPYEKSITSERFRGRIHFEFDKCIACEVCVRVCPIDLP 77  Japanese rice
P26525     81 VVDWEFNKAVKKKELKHYSIDFGVCIFCGNCVEYCPTNCLSMTEEYELAAYDRHDLNYDNVALGRLPYKVTEDPMVTPLR 160 Synechocystis sp. ...
P06253     80 VVDWELKKTIKKKQLKNYSIDFGVCIFCGNCVEYCPTNCLSMTEEYELSTYNRHELNYDQIALGRLPISIIEDSTIENIF 159 liverwort
NP_039448  78 LVDWRFEKDIKRKQLLNYSIDFGVCIFCGNCVEYCPTNCLSMTEEYELSTYDRHELNYNQIALSRLPISIMGDYTIQTIR 157 Japanese rice
P26525    161 ELGYLPKGVIEPHnlpKGSQRAGQHPE 187 Synechocystis sp. PCC 6803 substr. Kazusa
P06253    160 NLTSLPKGKIEGH---IYSRNITNIVN 183 liverwort
NP_039448 158 NSTQS-KIDEEKS---WNSRTITDY-- 178 Japanese rice
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap