Conserved Protein Domain Family
mgtE

?
TIGR00400: mgtE 
Mg2+ transporter (mgtE)
This family of prokaryotic proteins models a class of Mg++ transporter first described in Bacillus firmus. May form a homodimer. [Transport and binding proteins, Cations and iron carrying compounds]
Statistics
?
PSSM-Id: 129495
View PSSM: TIGR00400
Aligned: 3 rows
Threshold Bit Score: 615.681
Threshold Setting Gi: 499192198
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_010872029  11 NPDREELqkLVRaqIETLLETSQFDAAKTILTPVQPADIADVIESLPSRLQVLAFRLLSKNEAIDVYEHLAPPVQESLLE 90  Synechocystis s...
WP_003232543   4 NMTYDEL--ILR--IIILLRDGKIRDFRSVIDELQPYDMAFIFKEMPEKHRARYLSYLTVDDITDMIGELEREFQLVVLN 79  Bacillus
WP_010889738   1 MIDIDEL--------RIFLKEKSYSKIKEKFLKXDSXDIAEALKRLNGTELILLYRFLPKKIAVETFSNFDQSTKNKLAN 72  Lyme disease sp...
WP_010872029  91 DFKHPEVLEIFNQMSPDDRVRLLDELPAKVVRQLFKHLSNEERKATSLLLGYKPETAGRIMTTEYVSLKEDYTASQALDH 170 Synechocystis s...
WP_003232543  80 KVGKTKATLAMNKMDNDDLAQLLEEMDEELKEQLLSSMEASESKAVQLLMNYPADSAGRMMTNRYVWIPQHYTVKDAVVK 159 Bacillus
WP_010889738  73 SFTNKEISEMIDELNLDDVIDLLEEVPANVVQRFLASSTEENREIINKFLSYSDDSAGSIVTIEYVELKEDFTVGKALDY 152 Lyme disease sp...
WP_010872029 171 IRHIATSFETIYVLYVTNESRRLTGTLSLRNLVMAKPEEYIGQIMVPDVVSVHTNTDQEE-VARTIQHYDFLAVPVVDSE 249 Synechocystis s...
WP_003232543 160 LKSFAEIAESINYLYVINESKQLVGVLSYRDLILGEPEEKVQDLMFTRVISADALQDQEE-VARLIERYDFLAIPVVEEN 238 Bacillus
WP_010889738 153 IRRVAKTKEDIYTYYITDDEKHLKGVIKIEDLILAKDDVILSSIMRSSGFYIVGVNDEKEdVALLFQKHDITSVPVVDNE 232 Lyme disease sp...
WP_010872029 250 QRLVGIVTVDDVIDILEEEATEDiYTAGGVQSQgDDYFKSSLMTVARKRVVWLFILLVTNTLTSQVIHSQEDVLQKTIAL 329 Synechocystis s...
WP_003232543 239 NVLVGIVTVDDIIDVVIREADED-YEKFAASGK-DITFDTKAYVAAYRRLPWLILLLFIGLISGSIISYFEDALKQVVAL 316 Bacillus
WP_010889738 233 GRMIGVIIIDDILEVIQSVNTEDfQMIAAVKPLdTSYLDTSILVMTKNRIIWLLVLMVSSTFTATIISNYQNLMLSLVVL 312 Lyme disease sp...
WP_010872029 330 AAFIPLLIDAGGNVGAQSSTVVIRGLNTEDVRLTQVLPVIAREGGAGALLGLMLGIVVTVWAYFLQG-----DWLVAITV 404 Synechocystis s...
WP_003232543 317 AFFMPMVSGMTGNTGTQSLAVVIRGLSKEEMNKKTIVRLIFREFRTSIFIGAVCSVLIAIVSIIWQG-----NALLGFVV 391 Bacillus
WP_010889738 313 ANFIPLLMDTSGNAGSQASALIIRELALGTVKVKDFFKVFLKEICVSILVGAILASVNFLRIVFFVAphhsdKLKIAFVV 392 Lyme disease sp...
WP_010872029 405 GSSLFIISLLAAFAGGGLPFLFKSMKLDPALMSAPFITTAVDVLGVAIYLLIARSLLGI 463 Synechocystis sp. PCC 6803
WP_003232543 392 ASSLFLTLIIGTMSGTIIPIILHKLKVDPAIASGPLITTLNDILSLLIYFGIATAFIHS 450 Bacillus
WP_010889738 393 SSCLMVSLTVAKILGGLLPIVAKLLKLDPALMAGPLITTIADAITLIAYFNIAKWVLVS 451 Lyme disease spirochete
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap