Conserved Protein Domain Family
mauM_napG

?
TIGR00397: mauM_napG 
MauM/NapG family ferredoxin-type protein
MauM is involved in methylamine utilization. NapG is associated with nitrate reductase activity. The two proteins are highly similar. [Energy metabolism, Electron transport]
Statistics
?
PSSM-Id: 129492
View PSSM: TIGR00397
Aligned: 3 rows
Threshold Bit Score: 353.066
Threshold Setting Gi: 2494441
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q51659  10 KVTRRDAMADAARAVGVACLGGFSLAALVRTASPVDARAIRPPGALPEQDFLAACVHCGLCVQACPYGTLSLAEWSDEAE 89  Paracoccus denitrific...
Q50235  13 EPERRKVFRKVFRQLGAATVITMFGKAVLDSRPARAASVLRPPGALPEPEFNAACIRCGLCVEACPLDILHLASWSDPAP 92  Methylophilus methylo...
Q50423  17 KPERRLMFKQLTRRVGVAVVGSIFGSALLRSRPAPAATVLRPPGALAEKDFQSACVRCGLCVEDCPFDILKLASWADPAP 96  Methylobacillus flage...
Q51659  90 LGTPFFTPREVPCYMCKDVPCARACPTGALDRDIPSIRDADMGVAVLVGHETCLNYKGLNCSICVRVCPIRGDAISLEPQ 169 Paracoccus denitrific...
Q50235  93 TGTPYFVGRTDPCRMCPDIPCARACPTGALSPLLTDIKKADMGVAVLVGHETCLNYKGLTCSICVRVCPIIGEAISLKQI 172 Methylophilus methylo...
Q50423  97 MGTPFFTARDEPCRMCQDIPCVRACPTGALNPLLTDIRKADMGVAVLVDHETCLNYKGLNCSICVRVCPIRGEAISLKPI 176 Methylobacillus flage...
Q51659 170 EIDGRRVMIPVVHSASCTGCGTCEKQCVLGHAAIRVLPRDLGLGGPGRNRAGR 222 Paracoccus denitrificans PD1222
Q50235 173 KNERGVLQIPTVDSSKCTGCGTCEKHCVLSEAAIRLLPRELGLGVEGAQSVGR 225 Methylophilus methylotrophus
Q50423 177 QNERGLLQIPTVDSTKCTGCGTCEKHCVLSEAAIRVLPRELGLGVSGANSAGR 229 Methylobacillus flagellatus KT
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap