Conserved Protein Domain Family
kpsF

?
TIGR00393: kpsF 
KpsF/GutQ family protein
This model describes a number of closely related proteins with the phosphosugar-binding domain SIS (Sugar ISomerase) followed by two copies of the CBS (named after Cystathionine Beta Synthase) domain. One is GutQ, a protein of the glucitol operon. Another is KpsF, a virulence factor involved in capsular polysialic acid biosynthesis in some pathogenic strains of E. coli. [Energy metabolism, Sugars]
Statistics
?
PSSM-Id: 129488
View PSSM: TIGR00393
Aligned: 4 rows
Threshold Bit Score: 401.878
Threshold Setting Gi: 7388494
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P45395        50 GKVVVMGMGKSGHIGRKMAATFASTGTPSFFVHPGEAAHGDLGMVTPQDVVIAISNSGESSEITALIPVLKRLHVPLICI 129 Escherichia col...
P45313        67 GRLVIGGIGKSGLIGKKMVATFASTGTPSFFLHPTEAFHGDLGMLKPIDIVMLISYSGETDDVNKLIPSLKNFGNKIIAV 146 Haemophilus inf...
O25971        50 GKLVIVGVGKSALVAQKIVASMLSTGNRSAFLHPTEAMHGDLGMVEKNDVVLMISYGGESLELLNLVSHLKRLSHKIITF 129 Helicobacter py...
WP_001287420  43 GKVVVSGIGKSGHIGKKIAATLASTGTPAFFVHPAEALHGDLGMIESRDVMLFISYSGGAKELDLIIPRLEDKSIALLAM 122 Enterobacteriaceae
P45395       130 TGRPESSMARAADVHLCVKVAKEACPLGLAPTSSTTATLVMGDALAVALLKARGFTAEDFALSHPGGALGRKLLLRVNDI 209 Escherichia col...
P45313       147 TSNKNSTLARHADYVLDITVEREVCPNNLAPTTSALVTLALGDALAVSLITARNFQPADFAKFHPGGSLGRRLLCKVKDQ 226 Haemophilus inf...
O25971       130 TKSPNSSLSKLGDYYLSLKIQKEACPINTAPTTSTTLTLALGDVLMACLMRAKNFSQEDFASFHPGGLLGKKLFVKVKDL 209 Helicobacter py...
WP_001287420 123 TGKPTSPLGLAAKAVLDISVEREACPMHLAPTSSTVNTLMMGDALAMAVMQARGFNEEDFARSHPAGALGARLLNKVHHL 202 Enterobacteriaceae
P45395       210 MHTGdeIPHVKKTASLRDALLEVTRKNLGMTVICDdNMMIEGIFTDGDLRRv-FDMGVDVRQLSIADVMTPGGIRVR-PG 287 Escherichia col...
P45313       227 MQTR--LPTILPTTNFTDCLTVMNEGRMGVALVME-NEQLKGIITDGDIRRalTANGAGTLNKTAKDFMTSSPKTIH-QD 302 Haemophilus inf...
O25971       210 LQTTn-LPLIAPSTSFKDALIEMSEKRLGSAILVNeANELVGVLSDGDVRR--ALLKGVSLKSEVRHFATLKPKSFKnLD 286 Helicobacter py...
WP_001287420 203 MRRDdaIPQVALTASVMDAMLELSRTGLGLVAVCDaQQQVQGVFTDGDLRR--WLVGGGALTTPVNEAMTVGGTTLQ-SQ 279 Enterobacteriaceae
P45395       288 ILAVEALNLMQSRHITSVMVADGD-HLLGVLH 318 Escherichia coli K-12
P45313       303 EFLSKAEDFMKAKKIHSLVVVNDEnHVVGLVE 334 Haemophilus influenzae Rd KW20
O25971       287 ALLLEALEFLERHKIQLLVCVDDHnKVLGVLH 318 Helicobacter pylori 26695
WP_001287420 280 SRAIDAKEILMKRKITAAPVVDENgKLTGAIN 311 Enterobacteriaceae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap