Conserved Protein Domain Family
glyQ

?
TIGR00388: glyQ 
glycyl-tRNA synthetase, tetrameric type, alpha subunit
This tetrameric form of glycyl-tRNA synthetase (2 alpha, 2 beta) is found in the majority of completed eubacterial genomes, with the two genes fused in a few species. A substantially different homodimeric form (not recognized by this model) replaces this form in the Archaea, animals, yeasts, and some eubacteria. [Protein synthesis, tRNA aminoacylation]
Statistics
?
PSSM-Id: 129483
View PSSM: TIGR00388
Aligned: 5 rows
Threshold Bit Score: 562.924
Threshold Setting Gi: 3024685
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P00960   7 RTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRELGPEPMAAAYVQPSRRPTDGRYGENPNRLQHYYQFQVV 86  Escherichia coli K-12
P54380   1 MNIQDMILTLQKHWSSQGCVLMQAYDVEKGAGTMSPYTFLRSIGPEPWKVAYVEPSRRPADGRYGENPNRLYQHHQFQVI 80  Bacillus subtilis sub...
Q55716   3 ITFQAVIAKLNEFWAQQGCLIAQPFDTEKGAGTMNPHTFLRAIGPEPWSVAYVEPCRRPTDGRYGENPNRVQHYFQYQVL 82  Synechocystis sp. PCC...
P43821   8 KTFQGMILALQEYWANQGCTIVQPFDMEVGAGTSHPMTALRALGPEPMAFAYVQPSRRPTDGRYGENPNRLQHYYQFQVV 87  Haemophilus influenza...
P56453   2 QDFSSLLLKLQEYWKNQGCLVIQPYDIPAGAGTFHPATLLRSLDKKPWNVAYVAPSRRPTDGRYGENPNRLGSYYQFQVV 81  Helicobacter pylori 2...
P00960  87 IKPSPDNIQELYLGSLKELGMDPTIHDIRFVEDNWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYG 166 Escherichia coli K-12
P54380  81 IKPSPDNIQELYLDSLRALGIDPLEHDIRFVEDNWENPSLGCAGLGWEVWLDGMEITQFTYFQQVGGLECKPVSVEITYG 160 Bacillus subtilis sub...
Q55716  83 IKPSPDNIQEVYLDSLRALGIQPEDHDIRFVEDNWESPTLGAWGVGWEVWLDGMEVTQFTYFQQCGGIDCRPVSIEITYG 162 Synechocystis sp. PCC...
P43821  88 IKPSPDNIQELYLGSLEMLGFDPTKNDIRFVEDNWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEVTYG 167 Haemophilus influenza...
P56453  82 IKPSPSNIQELYLKSLEVLGINLNEHDIRFVEDNWESPTLGAWGLGWEVWLDGMEVTQFTYFQQVGGIACSPIPVEITYG 161 Helicobacter pylori 2...
P00960 167 LERLAMYIQGVDSVYDLVWSDGplgkTTYGDVFHQNEVEQSTYNFEYADVDFLFTCFEQYEKEAQQLlaLENPLPLPAYE 246 Escherichia coli K-12
P54380 161 IERLASYIQDKENVFDLEWTSG----FTVKDLFMMAEYEHSVYTFETSDVDMLFQLFSTYEKEAIKQ--MDNGLVHPAYD 234 Bacillus subtilis sub...
Q55716 163 LERLAMYLQNVEAIDQIQWNEK----LSYGDIFWQGEVEQCTYNFEASNPDLLFQLFALYEQEAGQL--IERGLALPSLE 236 Synechocystis sp. PCC...
P43821 168 LERLAMYIQGVDSVYDLVWSDGplgkTTYGDVFHQNEVEQSTYNFEHANTDFLFYCFDQYEKEAQELlaLEKPLPLPAYE 247 Haemophilus influenza...
P56453 162 LERLAMYVQKVENILEIEWAKKnhdsVNYAQVHLESEYEFSKYHFETASVKRLLEMFKNAQAEALHC--LENKLPLPAYD 239 Helicobacter pylori 2...
P00960 247 RILKAAHSFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASREALGFPMCNK 301 Escherichia coli K-12
P54380 235 YVLKCSHTFNLLDAKGAISVTERTGYIARVRNLARKVAKTYYEEREKLGFPMLKG 289 Bacillus subtilis subsp. subtilis str. 168
Q55716 237 YVLKCSHAFNLLDARGVIAVTERTRYIGRIRNLAREVAHIYLQQREALGFPLDKK 291 Synechocystis sp. PCC 6803 substr. Kazusa
P43821 248 RILKAAHSFNLLDARKAISVTERQRYILRIRALTKGVAEAYYASREALGFPGCKK 302 Haemophilus influenzae Rd KW20
P56453 240 FVMLCSHFFNILDARKAISVAERQNYILQIRDLAKGCALLYKEQEEEREERLKNA 294 Helicobacter pylori 26695
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap