3K8N


Conserved Protein Domain Family
dsbE

?
TIGR00385: dsbE 
Click on image for an interactive view with Cn3D
periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily
Involved in the biogenesis of c-type cytochromes as well as in disulfide bond formation in some periplasmic proteins. [Protein fate, Protein folding and stabilization]
Statistics
?
PSSM-Id: 129481
View PSSM: TIGR00385
Aligned: 6 rows
Threshold Bit Score: 267.028
Threshold Setting Gi: 134044263
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3K8N_A   6 L-LIPLIIFLAIAAALLWQLARNAEGDDPTNLESALIGKPVPKFRLESLDNPgQFYQaDVLTQGKPVLLNVWATWCPTCR 84  Shigella flexneri
P45038   5 L-LVPLILFLSITIAFLVQLKRNAQGEDIKALESALVGKPVPAKNLTELFEN-KTYTnELFQQGEPVLLNVWATWCPTCY 82  Haemophilus influenza...
P33926   6 L-LIPLIIFLAIAAALLWQLARNAEGDDPTNLESALIGKPVPKFRLESLDNPgQFYQaDVLTQGKPVLLNVWATWCPTCR 84  Escherichia coli
P44943   5 L-IFFTPLFVLLGVCILLIAGLNQ---DPKKIASALIDKPVPEFYQANLHEPsQIVSpKEFPK-QPFLLNVWGSWCGYCK 79  Haemophilus influenza...
P52236   7 MmLLPVAIFAGFAGLSGWALLRDD----PDALPSAMIGREAPSVGEATLPGKvQLTD-EMLRQPGVKLVNFWASWCPPCR 81  Paracoccus denitrific...
P45409   6 LaLLPLIVFGGIAHGAKMLYDQDFHGKNIAEIPSALSHQGADAEPAAARRATlPALT-DAAIKGKLTLVNVFASWCLPCR 84  Rhizobium leguminosar...
3K8N_A  85 AEHQYLNQLSAQG-IRVVGMNYKDDRQKAISWLKELGNPYALSLFDGDGMLGLDLGVYGAPETFLIDGNGIIRYRHAGDL 163 Shigella flexneri
P45038  83 AEHQYLNKLAKEG-VRIIGLDYKDESPKAMKWLKDLGNPYQVVLKDEKGSFGLDLGVYGAPETFIVDGKGVIHYRYAGDV 161 Haemophilus influenza...
P33926  85 AEHQYLNQLSAQG-IRVVGMNYKDDRQKAISWLKELGNPYALSLFDGDGMLGLDLGVYGAPETFLIDGNGIIRYRHAGDL 163 Escherichia coli
P44943  80 EEHPLLIEIAKT--LPIVGVDYRDNRQNGIKMLKRMGNPFILTIDDSHGELGLKLGVDGAPETYLVDENGVIRYRHSGLL 157 Haemophilus influenza...
P52236  82 AEHPTLTELSAR--LPVYGVDLKDPEGAALGFLSEHGDPFHALAADPRGRVAIDWGVTAPPETFIIDGSGRILHRHAGPL 159 Paracoccus denitrific...
P45409  85 DEHPVLKELAKDGrLNIVAINYKDQSDNALRFLGELGNPYQAIGIDPNGKAAIDWGVYGIPESYLVGADGTILYKRVGPS 164 Rhizobium leguminosar...
3K8N_A 164 NPRVWEEEIKPLWEK 178 Shigella flexneri
P45038 162 NEKVWTQTLKPIYDK 176 Haemophilus influenzae Rd KW20
P33926 164 NPRVWEEEIKPLWEK 178 Escherichia coli
P44943 158 DKETWQTVFLPKIEA 172 Haemophilus influenzae Rd KW20
P52236 160 VREDYTNRFLPELEK 174 Paracoccus denitrificans PD1222
P45409 165 TNISLKEGLVPAMEK 179 Rhizobium leguminosarum bv. viciae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap