Conserved Protein Domain Family
TIGR00375

?
TIGR00375: TIGR00375 
TIGR00375 family protein
The member of this family from Methanococcus jannaschii, MJ0043, is considerably longer and appears to contain an intein N-terminal to the region of homology. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 161657
View PSSM: TIGR00375
Aligned: 3 rows
Threshold Bit Score: 558.758
Threshold Setting Gi: 489338930
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q60348       386 NKQLQIFIGWW--------RGDKGVTTSEILMNQLRLISLRLGFIITFSKH-----VPKNPKIGD-REVIKYHARWQG-- 449 Methanocaldococ...
WP_010876918   4 NADLHIHSCFS--------RATSRNMVIDNIAPQARLKGLQLVGTGDALHP-----GWRKIIAES-TEYEGDGIYGRD-- 67  Methanothermoba...
WP_003246128   5 yADLHIHIGRTftgravkiTGAKTLTLDRILVEASEHKGIELLGIIDCHSPevileLEEGISSGKyRELDGGGIRYRStt 84  Bacillales
Q60348       450 -----RVSILDEKIVDELKNEDIKLPKKDVRYGWIKGNYLYAPIIRIGREYYDgFVYNLEVED-DSSYVTVSGTLHnCFT 523 Methanocaldococ...
WP_010876918  68 -----ECSFVITAEVEDSRRVHHLLILPSLEAAEEIAGRMPSASTTDGRPRVR-MNGAQILEL-VHEYDGMAGPSH-AFT 139 Methanothermoba...
WP_003246128  85 lllgsELEIYDEAC---SGPIHVLVFMPTLADMKQFSNWLSARLKNIHLSSQRiYETGLNLQKkVQDMGGLFIPAH-IFT 160 Bacillales
Q60348       524 PWTSLYKSFDSIYDCYNKKP---DFVELGLSADTDMADMIPELRDLPFLSNSDAHSYHPHRLGREFNQIEVDYIGgiedn 600 Methanocaldococ...
WP_010876918 140 PWTSMYKSYDSYMDCYGARP---DFLELGLSADTDMADKIAELADIPFLTNSDAHSPWPHRLGREFNQFEMEDVS----- 211 Methanothermoba...
WP_003246128 161 PHKSLYGKGVKSSLTEVFDPsmiDAVELGLSCDTDMASHVSQLNPYPFLTNSDAHSLG--KIGREYNELYVQSADft--e 236 Bacillales
Q60348       601 FEQIKKAIKHNKIIANYGLDPKLGKYHLTACSKCHTRFKLEDAKKYNWKCPkCGGSIKKGVLSRVEELSDG-KIEHPKFR 679 Methanocaldococ...
WP_010876918 212 FTSLRRAIGKCRIRANYGLDPRLGKYHMTACTRCYRIYSPEEALEMDMRCP-CGGKIKKGVDYRIYELSTWdEPHHPPHR 290 Methanothermoba...
WP_003246128 237 FALALKGQDDRKIIANYGLDPLLGKYYQTACEACGEPAVS--GETACANCG--KARFTKGVSDRLRELSDQ--LEVRVPR 310 Bacillales
Q60348       680 PPYYKLIPLAEMISLTIGKGIFTKAVQSLWEEFIKKYGNEIEVLINADIDELSKIH-PKVAETINLFRKGKIYIYPGGGG 758 Methanocaldococ...
WP_010876918 291 PPYVHLMPLAEIIGMKYDKGVTTKFVQGIWEKLVGEFGTEIRVLLDAPLEDIAALD-TGVAVAVEAFRNGSLIVIPGGGG 369 Methanothermoba...
WP_003246128 311 PRYVHQIPLQFVPGVGPKT----------LDKLKKAFGTEMAVLHEAAEEDLARVVpPKTAALIVKARSGKLELKAGGGG 380 Bacillales
Q60348       759 EYGKI 763 Methanocaldococcus jannaschii DSM 2661
WP_010876918 370 KYGEI 374 Methanothermobacter thermautotrophicus
WP_003246128 381 TYGKI 385 Bacillales
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap