Conserved Protein Domain Family
TIGR00374

?
TIGR00374: TIGR00374 
conserved hypothetical protein
This model is built on a superfamily of proteins in the Archaea and in Aquifex aeolicus. The authenticity of homology can be seen in the presence of motifs in the alignment that include residues relatively rare among these sequences, even though the alignment includes long regions of low-complexity hydrophobic sequences. One apparent fusion protein contains a Glycos_transf_2 region in the N-terminal half of the protein and a region homologous to this superfamily in the C-terminal region. [Unknown function, General]
Statistics
?
PSSM-Id: 129470
View PSSM: TIGR00374
Aligned: 7 rows
Threshold Bit Score: 175.648
Threshold Setting Gi: 7388464
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O26973        20 IVLSFLAVAVVIFLIGFfagfGDILRALEGTSPYFLALNFVLEAIILILWTLRWRLILNVVDDAPSFPRLMMLLFTSIFG 99  Methanothermoba...
O27329         9 IVIGVVALAAMILIIGP----GEIEDALRKADPVYVLMAVVLEFIILALFTLRWSITTRAVSIDVGKRHLFPMLLVGMAI 84  Methanothermoba...
Q58990        13 LIISFLFILAIMAYIGL----DKIIKVLINTNPEYVILAFILQILVSVILSARWKFIIKILGYSANFKNIFLLVLMGLFI 88  Methanocaldococ...
Q58478         1 -----------------------------------------------------------------------------MFI 3   Methanocaldococ...
O26478        10 FALSILLILALIIWMGP----SRIIRAVYMADWMIIAIALLIHMGVLAVRGLRWGFII--G-QPWRMRVNFMVKTIGLFA 82  Methanothermoba...
O28052         4 ILVSIAVTAIIFKYTES----ELTWSVIKRANWLLLIVAFLLQVSFWLLWALRMKLLSNYLGYRISFFHSLEITMASMFT 79  Archaeoglobus f...
WP_010880498  13 SVLLVFFLLLSFLFLAYrsfsPEALYLVGNLNKFYLLLAFFCLFLVHTFDNARLFIISRALGIKYSFLYGYITSFVNTFG 92  Aquifex aeolicus
O26973       100 NNITPGAAGG-EPLRAYLLREVEGTPFEIGFASSTADRVFEFIPFALISILSAVl-iMTWEISIWTRIVVSVLILVTIAG 177 Methanothermoba...
O27329        85 NNLTPSARGGgEPVRAYMLGKYSRASMESAFATVIADRGLDTFPFIFLAVLTIIgivLYFDLSRWILAALIASVVIIVVA 164 Methanothermoba...
Q58990        89 NNITPSMRGGgEAFRAYYLSKLEEIPKGLAFSTVVVERVLDTAIFLFFTLFVIG----YFVVTGFKYLEYLILSWIFLFS 164 Methanocaldococ...
Q58478         4 NSLVPAKLGD--VYRGYLLKKKTNESISLGVGTVFIERVFDLVAMISLLFISAY---LSFKSDIPKEILYSIKWGVIIIL 78  Methanocaldococ...
O26478        83 GNLSPMRSAG-EVMNALAGKKLNGIELSEGLSAGLTERFFDLGIGGGLLLLAAV---MVPVIRVIALFGAILSVLITYLI 158 Methanothermoba...
O28052        80 ASITPSSAGG-EPVRVKMLSDR-GVEVGTSAFIVLAERILDSMYFSTALPVFLI----VTGFSTSFGFKIAIIFITLLLV 153 Archaeoglobus f...
WP_010880498  93 ATVTPAHIGG-EGMAVYMLLRK-GISAHKVATAVTFKTVTGMVFFILCFPFLIL-----QTLKSPKNFINLFLILLVLLL 165 Aquifex aeolicus
O26973       178 FS-LAVYAGMNKKIAQRIALSVTRrLVSWFSRFREggisfagIHEKVIFYINRFNDGFSTAITDR-RVFVIGFFISLGMW 255 Methanothermoba...
O27329       165 FF-LALYVSVDRDAGERITGWILG-VVKRFYRKNHe-----rLERRVRSALHEFQSTMRMMLKEK-NVLVYGIPISFLIW 236 Methanothermoba...
Q58990       165 LTaIIIYLIANKGLLIKTVTKISKfICKYCSYNYD--------ETKILQSIEEFYNSMKFFKNKRgWEVVVAIFLSVMRY 236 Methanocaldococ...
Q58478        79 FL--IILIFGFLIVNSKINLKNKK----------------------LEAILMNFEKGLKAVKLNT---LPLLITLSFTGW 131 Methanocaldococ...
O26478       159 YL-VNWREEKGLRIYQRIHSIIERlPVSEETLEN--------LYERLTSGIKGMIGYTRSYSNFT--SLGVIFILSLLSW 227 Methanothermoba...
O28052       154 FLyILYRIFRNESSIDKFAQLLYKaVRKFNEKKAEk------YSSTFSRELRRFREATIKMLSDSpSGILVLYLVTLVMW 227 Archaeoglobus f...
WP_010880498 166 FT--PLFFTGIKKFLKKKDSEGLG--------------------SKLRKFLVKYLGAVKFFYKRKkAEFLLASLSSIGLY 223 Aquifex aeolicus
O26973       256 ALDVCRLYVCFLAVGVSPPAVPLIIIYTVGILISLLPILPGSLGLREGILVGLFAVAGIGADYVMAASVVDRIASYIAPT 335 Methanothermoba...
O27329       237 ILEIIRVYLIFTAFGTDISLLVIAEVFILATLIGMIPLLPGGLGAVDGIMIVFYSYAGVSPSVSAAATVVERLISFWMIS 316 Methanothermoba...
Q58990       237 IFDILKLWLLFLSLSYVVSVICVSAVYLITLLSGVLSITPSGFGTADTVMILSFSAFNIPPSVAAAVTLLDRLVSYILPT 316 Methanocaldococ...
Q58478       132 FIEGLTVYFIFLSLNLNLEILFGVFSDLASSLLTAIPLTPSGLGVVEYALIYILKLKNIDYSGAFAVLILYRLISYFSIV 211 Methanocaldococ...
O26478       228 LMECLRLYLVFMAFGVETSFSAVIIIFLLANLVGILSALPGGMGSMEVSMAGLFVVFGVPGFLAGSIALVDRIISFWMVT 307 Methanothermoba...
O28052       228 SASFAIPSVILVALGYDAYFLYSYTAQLIIVIVSLVPLTPGSSGIAEVSMAYLYSNF-VPTNVLGVLVGLWRLITYHTNI 306 Archaeoglobus f...
WP_010880498 224 LSFLFIAFFLLLSFGKEVSPLEILSLQLGLLYAIFVSPTPGGSGVGEIGGYVIFAGL-LGQNEVGVFVLLWRLISQYFSA 302 Aquifex aeolicus
O26973       336 LIGLIAAIYYGKQMTS 351 Methanothermobacter thermautotrophicus str. Delta H
O27329       317 AMGVAAIPYFGSSVSE 332 Methanothermobacter thermautotrophicus str. Delta H
Q58990       317 ILGYIAMLIIKREIDK 332 Methanocaldococcus jannaschii DSM 2661
Q58478       212 LFGAIMFYIVERNILK 227 Methanocaldococcus jannaschii DSM 2661
O26478       308 ALGAIFSSCYAGEIFD 323 Methanothermobacter thermautotrophicus str. Delta H
O28052       307 FFGAISVNYSLIKSKF 322 Archaeoglobus fulgidus DSM 4304
WP_010880498 303 FLGGILFFICLLIDTK 318 Aquifex aeolicus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap