Conserved Protein Domain Family
TIGR00373

?
TIGR00373: TIGR00373 
transcription factor E
This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain. [Transcription, Transcription factors]
Statistics
?
PSSM-Id: 129469
View PSSM: TIGR00373
Aligned: 3 rows
Threshold Bit Score: 233.983
Threshold Setting Gi: 499180720
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q58187         4 DPLVQEVLFNIFEgdEKGFEVIDVLLeKGETTEEEIAKELGVKLNVVRKLLYKLYDARLVDYKRWKDEDTNWYSYTWLPT 83  Methanocaldococ...
WP_010877276   8 QELIHEVITEEEE--EEAIPVLECLM-KGKVTDEEISEKTQLKLNIVRRILYRLYDAGVASYKRSKDPETQWYTYTWKFE 84  Methanothermoba...
WP_010878260  10 EELLNELVGRAAG---EVGLILFSLGiEGEFTDDQLSLELGIEINEIRKALFALYEIGLADYVRRRDDETGWMEYYWRIN 86  Archaeoglobus f...
Q58187        84 LEKLPYVVKKKINELIKDLEKKLEFEKNNMFFFCPNCNVRFTFEEAMDYGFSCPGCGNMLQEFDNSELIKDLEEQIKFLK 163 Methanocaldococ...
WP_010877276  85 PEKVTEMIKRKHSEIVRKLREALEFEENNMFFVCVNGHYRFTFDEATEENFTCPECGSKMEFMDNSEIIQEIKDELSLYE 164 Methanothermoba...
WP_010878260  87 YDKALDVLKRELEKTAKKLREKIEAETSTIYYICPNMCVKVSYNDAMELNFTCPRCGAMLDYLDCSKAIEKieeevrrie 166 Archaeoglobus f...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap