Conserved Protein Domain Family
TIGR00370

?
TIGR00370: TIGR00370 
sensor histidine kinase inhibitor, KipI family
[Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 129467
View PSSM: TIGR00370
Aligned: 3 rows
Threshold Bit Score: 347.225
Threshold Setting Gi: 2495572
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P42967  10 LGDSAMMIRFGEEINEQVNGIVHAAAAYIEEQpfPGFIECIPAFTSLTVFY-DMYEVYKHLPQGISSPFESVKrdveerl 88  Bacillus subtilis
P44299   6 ISESAVVCSLPPPASIQQQRQLWAFARQLQSE--QDIVEVVLGMNNLTVFT-DFFVDFKPLVQRLEQLWAELK------- 75  Haemophilus influenza...
P75744   9 IGETAVVLELEPPVTLASQKRIWRLAQRLVDM--PNVVEAIPGMNNITVILrNPESLALDAIERLQRWWEESE------- 79  Escherichia coli
P42967  89 aeiaeDYEVNRRIVEIPVCYGGEFGPDLEEVAKINQLSPEEVIDIHTNGEYVVYMLGFAPGFPFLGGMSKRIAAPRKSSP 168 Bacillus subtilis
P44299  76 -----VSDFQGRHIEIPVIYGGERGQDLSDVAKFHQTTPERIIQMHSEPIYTVYMIGFQAGFPYLGGLPENLHTPRRATP 150 Haemophilus influenza...
P75744  80 -----ALEPESRFIEIPVVYGGAGGPDLAVVAAHCGLSEKQVVELHSSVEYVVWFLGFQPGFPYLGSLPEQLHTPRRAEP 154 Escherichia coli
P42967 169 RPSIPAGSVGIAGLQTGVYPISTPGGWQLIGKTPLALFRPQENPPTLLRAGDIVKFV 225 Bacillus subtilis
P44299 151 RTVVPAGSVGIGGAQTGIYPFSSPGGWQLIGYTKQALFDKNQAQPTLLQAGDTVKFI 207 Haemophilus influenzae Rd KW20
P75744 155 RLLVPAGSVGIGGPQTGVYPLATPGGWQLIGHTSLSLFDPARDEPILLRPGDSVRFV 211 Escherichia coli
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap