4K49,4K4C,1SC0,1PSU


Conserved Protein Domain Family
unchar_dom_1

?
TIGR00369: unchar_dom_1 
Click on image for an interactive view with Cn3D
uncharacterized domain 1
Most proteins containing this domain consist almost entirely of a single copy of this domain. A protein from C. elegans consists of two tandem copies of the domain. The domain is also found as the N-terminal region of an apparent initiation factor eIF-2B alpha subunit of Aquifex aeolicus. The function of the domain is unknown.
Statistics
?
PSSM-Id: 161843
View PSSM: TIGR00369
Aligned: 13 rows
Threshold Bit Score: 123.994
Threshold Setting Gi: 141254
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4K49_C        19 NMVGFLDIRFEHIGDDTL-EATMPVDSRTKQP---FGLLHGGASVVLAESIG-SVA-GYLCTEGEQKVVGLEINANHVRS 92  Escherichia col...
P77781        19 NMVGFLDIRFEHIGDDTL-EATMPVDSRTKQP---FGLLHGGASVVLAESIG-SVA-GYLCTEGEQKVVGLEINANHVRS 92  Escherichia col...
P45083        19 SAVSHLGIEISAFGEDWI-EATMPVDHRTMQP---FGVLHGGVSVALAETIG-SLA-GSLCLEEGKTVVGLDINANHLRP 92  Haemophilus inf...
P14205         6 TLLEALGIEIVENTAERC-VAVMPVDHRTVQP---FGYLHGGASVALAETAAsAGA-QNLIDHTTQACVGLEINANHLKS 80  Bacillus subtil...
P76084        17 ACAKALGIDIISMDEGFA-VVTMTVTAQMLNG---HQSCHGGQLFSLADTAF-----AYACNSQGLAAVASACTIDFLRP 87  Escherichia col...
O28020        31 KLFELLDARILEMKEGYA-KVEMVVKKEHLNA---ANVCHGGIIFSLADLAF-----ALASNSHGKLALAIEVSITYMKA 101 Archaeoglobus f...
AAD03863      21 PFHQWLGLDIAELTDEAL-ILEMPWREEIVSNp-mIGSAHGGVLSALIDLTG---L-CTINALGGSARATADMLVDFHRP 94  Novosphingobium...
P20378        21 GLLSFLGVSVEDASDGEM-RLRIPYHEKLTNHgpgEGDVHGGIAATLIDTAGgLAVrSALPKPVAANVATIDLNVSYLRP 99  Halobacterium s...
WP_010889277  41 PIAATLGMETPRLEDVQEgRVVFRLKPQNFQYn-pIGSVHGGVYARLLDSAV-ACA-IQSTLPAGAMYTTLELKVNYIRP 117 Deinococcus rad...
P15050        19 TMVAHLGIVYTRLGDDVL-EAEMPVDTRTHQP---FGLLHGGASAALAETLG-SMA-GFMMTRDGQCVVGTELNATHHRP 92  Escherichia coli
4K4C_A        19 TMVAHLGIVYTRLGDDVL-EAEMPVDTRTHQP---FGLLHGGASAALAETLG-SMA-GFMMTRDGQCVVGTELNATHHRP 92  Shigella dysent...
1SC0_A        19 SAVSHLGIEISAFGEDWI-EATXPVDHRTXQP---FGVLHGGVSVALAETIG-SLA-GSLCLEEGKTVVGLDINANHLRP 92  Haemophilus inf...
1PSU_A        17 ACAKALGIDIISXDEGFA-VVTXTVTAQXLNG---HQSCHGGQLFSLADTAF-A----YACNSQGLAAVASACTIDFLRP 87  Escherichia coli
4K49_C        93 AREG--RVRGVCKPLHLGSRHQVWQIEIFDEKGRLCCSSRLTTAI 135 Escherichia coli K-12
P77781        93 AREG--RVRGVCKPLHLGSRHQVWQIEIFDEKGRLCCSSRLTTAI 135 Escherichia coli K-12
P45083        93 VRSG--KVTARATPINLGRNIQVWQIDIRTEENKLCCVSRLTLSV 135 Haemophilus influenzae Rd KW20
P14205        81 VKEG--TVKAIAEPVHIGRTTIVYHIHIYDEQERLICISRCTLAV 123 Bacillus subtilis subsp. subtilis str. 168
P76084        88 GFAGd-TLTATAQVRHQGKQTGVYDIEIVNQQQKTVALFRGKSHR 131 Escherichia coli K-12
O28020       102 AYEGe-KLVAEAKEVNLGNKTATYLMEVKNSANKLIALAKGTVYR 145 Archaeoglobus fulgidus DSM 4304
AAD03863      95 ATSG--PLRAIGRVVKLGKQLSVAETRIEDAGGRLLASGRGAYVG 137 Novosphingobium aromaticivorans
P20378       100 ARGD---LIADASVVRVGSTVGVAEISVVTPADTADAEPTEVAVG 141 Halobacterium sp. NRC-1
WP_010889277 118 LIAGgpEVQAIGEVVHVTRQTGVAEGRIVDEQGRIYAHATTTCLI 162 Deinococcus radiodurans
P15050        93 VSEG--KVRGVCQPLHLGRQNQSWEIVVFDEQGRRCCTCRLGTAV 135 Escherichia coli
4K4C_A        93 VSEG--KVRGVCQPLHLGRQNQSWEIVVFDEQGRRCCTCRLGTAV 135 Shigella dysenteriae Sd197
1SC0_A        93 VRSG--KVTARATPINLGRNIQVWQIDIRTEENKLCCVSRLTLSV 135 Haemophilus influenzae
1PSU_A        88 GFAGd-TLTATAQVRHQGKQTGVYDIEIVNQQQKTVALFRGKSHR 131 Escherichia coli
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap