Conserved Protein Domain Family
TIGR00368

?
TIGR00368: TIGR00368 
Mg chelatase-related protein
The N-terminal end matches very strongly a pfam Mg_chelatase domain. [Unknown function, General]
Statistics
?
PSSM-Id: 129465
View PSSM: TIGR00368
Aligned: 4 rows
Threshold Bit Score: 794.433
Threshold Setting Gi: 488733455
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P22787         6 VHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGYEYPAKKITINLAPADLPKEGGRYDLPI 85  Escherichia col...
P45049         6 VYSRASMGVQAPLVTIEVHLSNGKPGFTLVGLPEKTVKEAQDRVRSALMNAQFKYPAKRITVNLAPADLPKEGGRFDLPI 85  Haemophilus inf...
WP_010873683   5 VWSASLLGIDAIKVGVEVDVSAGLPAIAVVGLPDTAVQESRERVKAALKNAGFAFPVRRIVINLTPADLRKEGPSFDLPI 84  Synechocystis s...
WP_002656860   3 IYSHSSIGYEGELIEIEIDIKKGISGIDIVGLAGSEIKESRERVKSAIKNSNFHFPKNRILINLAPAGIKKLGTAFDLSI 82  Lyme disease sp...
P22787        86 AIALLAASEQLTANKLDEYELVGELALTGALRGVPGAISSATEAIKSGRK-IIVAKDNEDEVGLINGEGCLIADHLQAVC 164 Escherichia col...
P45049        86 AIGILAASDQLDASHLKQFEFVAELALTGQLRGVHGVIPAILAAQKSKRE-LIIAKQNANEASLVSDQNTYFAQTLLDVV 164 Haemophilus inf...
WP_010873683  85 GIGILAASEQVDAQLLGDYLFLGEMSLDGSLRAIAGVLPIAATAQKMGLAgIVVPSGNALEASVVQGLKVYGFDHIKEVV 164 Synechocystis s...
WP_002656860  83 AISIIKIQESKDDKNL-EILILGELQLDGKIRSIKAVLPAIALAKEKEIKfAIVPFENLEEASLIDGLNIWGVKDLKETI 161 Lyme disease sp...
P22787       165 AFLE--GKHALERP-----KPTDAVSRAlQHDLSDVIGQEQGKRGLEITAAGGHNLLLIGPPGTGKTMLASRINGLLPDL 237 Escherichia col...
P45049       165 QFLN--GQEKLPLAteivkESAVNFSGKnTLDLTDIIGQQHAKRALTIAAAGQHNLLFLGPPGTGKTMLASRLTGLLPEM 242 Haemophilus inf...
WP_010873683 165 DFLG--APEKFTPVnaqdaKQQWNTSLP-CLDLKDVKGQSHGRRALEIAAAGGHNLIFVGPPGSGKTMLARRLPGILPPL 241 Synechocystis s...
WP_002656860 162 KIIEqlNSNILPPRtntkpQSIIEKDYIiDYDFKNIKGQQRAKRAIEIAIAGGHNIMLFGPPGSGKTLSIKCAQSILPPL 241 Lyme disease sp...
P22787       238 SNEEALESAAILSLVNAESVQKQ-WRQRPFRSPHHSASLTAMVGGGAIPGPGEISLAHNGVLFLDELPEFERRTLDALRE 316 Escherichia col...
P45049       243 TDLEAIETASVTSLVQNELNFHN-WKQRPFRAPHHSASMPALVGGGTIPKPGEISLATNGVLFLDELPEFERKVLDALRQ 321 Haemophilus inf...
WP_010873683 242 QFEEALEVSQVHSVAGLLKERGQlIRQRPFRSPHHSASGPSLVGGGSFPRPGEISLAHRGVLFLDELTEFKRNVLEFLRQ 321 Synechocystis s...
WP_002656860 242 TNKELIETNRIWSISGKLIDRKI-IKQRPFRNPHHTASKEGIIGGGPNPLPGEVSLAHNGILFLDEALEFKKSILQSLRE 320 Lyme disease sp...
P22787       317 PIESGQIHLSRTRAKIT-YPARFQLVAAMNPSPTGHYQG--NHNRCTPEQTLRYLNRLSGPFLDRFDLSLEIPLPPPGIL 393 Escherichia col...
P45049       322 PLESGEIIISRANAKIQ-FPARFQLVAAMNPSPTGHYTG--THNRTSPQQIMRYLNRLSGPFLDRFDLSIEVPLLPQGSL 398 Haemophilus inf...
WP_010873683 322 PLEDGHVTISRTKQTIM-FPAQFTLIASTNPCPCGYFGDpiQACSCSPRQREMYWSKLSGPLMDRIDLQVAVNRLKPEEM 400 Synechocystis s...
WP_002656860 321 PIEDKSISISRASSKLFkYPANFQLMLAMNLCPCGNLGKknTDCFCSQQEISNYWKKLGAAMLDRIDIRVPTRAINNEKL 400 Lyme disease sp...
P22787       394 SKTVvPGESSATVKQRVMAARERQFKRQNK-----LNAWLDSPEIRQFCKLESEDAMWLEGTLIHLGLSIRAWQRLLKVA 468 Escherichia col...
P45049       399 QNTGdRGETSAQVREKVLKVREIQMERAGK-----INAYLNSKEIERDCKLNDKDAFFLEKALNKLGLSVRAYHRILKVS 473 Haemophilus inf...
WP_010873683 401 TSQG-QGESSEPVRQRVAKARAMAIARFSKdakisCNAEMQAGQLRQFCHLDENCRQLLEGAIKKLGLSARAMDRILKVS 479 Synechocystis s...
WP_002656860 401 LSET-SE-SSSEIKQRIIKARNIQNIRYENfaninKNSDLNSDHIEKFCELSAILKNDLIYILNKLNISSRATHSILKIA 478 Lyme disease sp...
P22787       469 RTIADIDQSDIITRQHLQEAVSYR 492 Escherichia coli K-12
P45049       474 RTIADLQGEQQIFQPHLAEALGYR 497 Haemophilus influenzae Rd KW20
WP_010873683 480 RTIADLGRSEHIQASHLAEAIQYR 503 Synechocystis sp. PCC 6803
WP_002656860 479 RTISDLKEEKNISREALLEAIEHR 502 Lyme disease spirochete
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap