Conserved Protein Domain Family
TIGR00363

?
TIGR00363: TIGR00363 
lipoprotein, YaeC family
This family of putative lipoproteins contains a consensus site for lipoprotein signal sequence cleavage. Included in this family is the E. coli hypothetical protein yaeC. About half of the proteins between the noise and trusted cutoffs contain the consensus lipoprotein signature and may belong to this family. [Cell envelope, Other]
Statistics
?
PSSM-Id: 129460
View PSSM: TIGR00363
Aligned: 3 rows
Threshold Bit Score: 437.025
Threshold Setting Gi: 1171732
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P28635  14 LIGSLALVGCGQDEKD-----PNHIKVGVIVGAEQQVAEVAQKVAKDKYGLDVELVTFNDYVLPNEALSKGDIDANAFQH 88  Escherichia coli K-12
P31728  12 IASALVLTGCKEDKKPeaaaaPLKIKVGVMSGPEHQVAEIAAKVAKEKYGLDVQFVEFNDYALPNEAVSKGDLDANAMQH 91  Haemophilus influenza...
P04846  15 LLAGILLAGCDQSSSD-----AKHIKVGVINGAEQDVAEVAKKVAKEKYGLDVELVGFSGSLLPNDATNHGELDANVFQH 89  Escherichia coli K-12
P28635  89 KPYLDQQLKDR-GYKLVAVGNTFVYPIAGYSKKIKSLDELQDGSQVAVPNDPTNLGRSLLLLQKVGLIKLKDGVGLLPTV 167 Escherichia coli K-12
P31728  92 KPYLDEDAKAKnLNNLVIVGNTFVYPLAGYSKKIKNVNELQDGAKVVVPNDPTNRGRALILLEKQGLIKLKDANNLLSTV 171 Haemophilus influenza...
P04846  90 RPFLEQDNQAH-GYKLVAVGNTFVFPMAGYSKKIKTVAQIKEGATVAIPNDPTNLGRALLLLQKEKLITLKEGKGLLPTA 168 Escherichia coli K-12
P28635 168 LDVVENPKNLKIVELEAPQLPRSLDDaqIALAVINTTYASQIGLTPAKDGIFVEDKESPYVNLIVTREDNKDAENVKKFV 247 Escherichia coli K-12
P31728 172 LDIVENPKKLNITEVDTSVAARALDD--VDLAVVNNTYAGQVGLNAQDDGVFVEDKDSPYVNIIVSRTDNKDSKAVQDFI 249 Haemophilus influenza...
P04846 169 LDITDNPRHLQIMELEGAQLPRVLDDpkVDVAIISTTYIQQTGLSPVHDSVFIEDKNSPYVNILVAREDNKNAENVKEFL 248 Escherichia coli K-12
P28635 248 QAYQSDEVYEAANKVFNGGAVKGW 271 Escherichia coli K-12
P31728 250 KSYQTEEVYQEAQKHFKDGVVKGW 273 Haemophilus influenzae Rd KW20
P04846 249 QSYQSPEVAKAAETIFNGGAVPGW 272 Escherichia coli K-12
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap