Conserved Protein Domain Family
nrfE

?
TIGR00353: nrfE 
c-type cytochrome biogenesis protein CcmF
The product of this gene is required for the biogenesis of C-type cytochromes. This gene is thought to have eleven transmembrane helices. Disruption of this gene in Paracoccus denitrificans, encoding a putative transporter, results in formation of an unstable apocytochrome c and deficiency in siderophore production. [Energy metabolism, Electron transport]
Statistics
?
PSSM-Id: 129451
View PSSM: TIGR00353
Aligned: 4 rows
Threshold Bit Score: 725.889
Threshold Setting Gi: 446849916
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P45037        53 AFAALFYLFAVNDFSVQYIVNNSNTTLPIYYRLSAVWGSHEGSLLLWIWLLAVWSFAVALLSKHLPQEAVARVLGIMGII 132 Haemophilus inf...
P44944        53 SIGLLAYSFAVDDFTLEYVAAHSNSQLPTFFKVAATWGGHEGSMLFWLFSLSLWLAAFAFFNRKNDRTFSAQSLSLLGLI 132 Haemophilus inf...
P33927        53 AFLVLVNAFVVNDFTVTYVASNSNTQLPVWYRVAATWGAHEGSLLLWVLLMSGWTFAVAIFSQRIPLDIVARVLAIMGMV 132 Escherichia col...
WP_000927172  44 AFGVLTYCFLISDFSVIYVAQHSYSLLSWELKLAAVWGGHEGSLLLWVLLLSAWSALFAWHYRQQTDPLFPLTLAVLSLM 123 Escherichia coli
P45037       133 SVGFVLFVLFTSNPFTRTFPdFPVDGKELNPMLQDVGLIFHPPLLYMGYVGFSVAFAFAIASLMTGKLDSAWARWSRPWT 212 Haemophilus inf...
P44944       133 CFGFAVFILFYSNPFGRIFP-APAEGRDLNPMLQDVGLIFHPPLLYVGYVGFAVNFAMSLSALIYNQSARQIARSMRGWV 211 Haemophilus inf...
P33927       133 SVGFLLFILFTSNPFSRTLPnFPIEGRDLNPLLQDPGLIFHPPLLYMGYVGFSVAFAFAIASLLSGRLDSTYARFTRPWT 212 Escherichia col...
WP_000927172 124 LAALLLFVVLWSDPFVRIFP-PAIEGRDLNPMLQHPGLIFHPPLLYLGYGGLMVAASVALASLLRGEFDGACARICWRWA 202 Escherichia coli
P45037       213 LAAWVFLTLGIVLGSWWAYYELGWGGWWFWDPVENSSFMPWLAGTALIHSLSVTEKRGSFKAWTVLLAILAFSLCLLGTF 292 Haemophilus inf...
P44944       212 LVSWLFLTIGIVLGAWWAYYELGWGGWWFWDPVENASLMPWLLGLALLHSLMATEKQGVFSYWTTLFSLLAFAFSVLGTF 291 Haemophilus inf...
P33927       213 LAAWIFLTLGIVLGSAWAYYELGWGGWWFWDPVENASFMPWLVGTALMHSLAVTEQRASFKAWTLLLAISAFSLCLLGTF 292 Escherichia col...
WP_000927172 203 LPGWSALTAGIILGSWWAYCELGWGGWWFWDPVENASLLPWLSATALLHSLSLTRQRGIFCHWSLLLAIVTLMLSLLGTL 282 Escherichia coli
P45037       293 LVRSGILVSVHAFASDPTRGLYILAYLVVVIGGSLALYAYK-GSQIRSRDNAERYSRESMLLLNNILLMTALCVVFLGTL 371 Haemophilus inf...
P44944       292 IVRSGALTSVHAFALDNTRGYVLLLIFFVLTALAFGLFALRaGSSSESAVKFQFISKSGGILLLNILLTIATVSTFLGTF 371 Haemophilus inf...
P33927       293 LVRSGVLVSVHAFASDPARGMFILAFMVLVIGGSLLLFAAR-GHKVRSRVNNALWSRESLLLANNVLLVAAMLVVLLGTL 371 Escherichia col...
WP_000927172 283 IVRSGILVSVHAFALDNVRAVPLFSLFALISLASLALYGWR-ARDGGPAVHFSGLSREMLILATLLLFCAVLLIVLVGTL 361 Escherichia coli
P45037       372 LPLVHKQLGLGSISIGAPFFDQMFLIIMTPFALLLGIGPLVKWR-RDQFSAIRTPvVICVFVMLIAGFALPYFLQDKitv 450 Haemophilus inf...
P44944       372 YPMLFQAMNWGSISVGSPYFNSIFFPIITAILILMVIVLSIRKGqFDRTLLIRCG-WLLIPSLILAGLMIWQQLRNN--- 447 Haemophilus inf...
P33927       372 LPLVHKQLGLGSISIGEPFFNTMFTWLMVPFALLLGVGPLVRWG-RDRPRKIRNLlIIAFISTLVLSLLLPWLFESKvva 450 Escherichia col...
WP_000927172 362 YPMIYGLLGWGRLSVGAPYFNRATLPFG-----LLM--LVV-----------------IVLATFVSG------------- 404 Escherichia coli
P45037       451 SSVLGSMMTVIIALLALYELQQRATHresffvgVrKLSRSHWGMMLAHLGVAMTVWGIAFSQNFSVERDVRMKVGESAQI 530 Haemophilus inf...
P44944       448 SALHFHAFAFVLLTLAIWLLFVTLWQn------WrQIRLSQFGMILAHCGVAIVTIGAVMSGYFGSEIGVRLAPQQSQTL 521 Haemophilus inf...
P33927       451 MTVLGLAMACWIAVLAIAEAALRISRg------T-KTTFSYWGMVAAHLGLAVTIVGIAFSQNYSVERDVRMKSGDSVDI 523 Escherichia col...
WP_000927172 405 -------------------------------------KRVQLPALVAHAGVLLFAAGVVVSSVSRQEISLNLQPGQQVTL 447 Escherichia coli
P45037       531 GRYDFKFTGVTDENGPNYIGGKAQIDISKDGQPEASLFAEKRFYTVSRMSMTEAAIAGGLTRDLYVALGEKLEDNSWALR 610 Haemophilus inf...
P44944       522 GQYEFHYRQFSNEIGPNFTAEVAFFDVTKNGKPYAEIIPERRYYDVRTMTMSEVGLDGGFWGDLYIVMGDSLGKGEFTFR 601 Haemophilus inf...
P33927       524 HEYRFTFRDVKEVTGPNWRGGVATIGVTRDGKPETVLYAEKRYYNTAGSMMTEAAIDGGITRDLYAALGEELENGAWAVR 603 Escherichia col...
WP_000927172 448 AGYTFRFECLDLQAKGNYTSEKAIVALFDHQQRIGELTPERRFYEARRQQMMEPSIRWNGIHDWYAVMGEKTGPDRYAFR 527 Escherichia coli
P45037       611 LYYKPFIRWIWIGGLFMALGGLLCMFDRRYR 641 Haemophilus influenzae Rd KW20
P44944       602 LHYKPLIRWLWAGGILMAFGALFSVFGLRRK 632 Haemophilus influenzae Rd KW20
P33927       604 LYYKPFVRWIWAGGLMMALGGLLCLFDPRYR 634 Escherichia coli K-12
WP_000927172 528 LYVQSGVRWIWGGGLLMIAGALLSGWRGKKR 558 Escherichia coli
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap