Conserved Protein Domain Family

TIGR00353: nrfE 
c-type cytochrome biogenesis protein CcmF
The product of this gene is required for the biogenesis of C-type cytochromes. This gene is thought to have eleven transmembrane helices. Disruption of this gene in Paracoccus denitrificans, encoding a putative transporter, results in formation of an unstable apocytochrome c and deficiency in siderophore production. [Energy metabolism, Electron transport]
PSSM-Id: 129451
Aligned: 4 rows
Threshold Bit Score: 725.889
Threshold Setting Gi: 446849916
Created: 7-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
WP_000927172 362 YPMIYGLLGWGRLSVGAPYFNRATLPFG-----LLM--LVV-----------------IVLATFVSG------------- 404 Escherichia coli
WP_000927172 405 -------------------------------------KRVQLPALVAHAGVLLFAAGVVVSSVSRQEISLNLQPGQQVTL 447 Escherichia coli
P45037       611 LYYKPFIRWIWIGGLFMALGGLLCMFDRRYR 641 Haemophilus influenzae Rd KW20
P44944       602 LHYKPLIRWLWAGGILMAFGALFSVFGLRRK 632 Haemophilus influenzae Rd KW20
P33927       604 LYYKPFVRWIWAGGLMMALGGLLCLFDPRYR 634 Escherichia coli K-12
WP_000927172 528 LYVQSGVRWIWGGGLLMIAGALLSGWRGKKR 558 Escherichia coli
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap