Conserved Protein Domain Family
azlC

?
TIGR00346: azlC 
4-azaleucine resistance probable transporter AzlC
Overexpression of this gene results in resistance to a leucine analog, 4-azaleucine. The protein has 5 potential transmembrane motifs. It has been inferred, but not experimentally demonstrated, to be part of a branched-chain amino acid transport system. Commonly found in association with azlD. [Transport and binding proteins, Amino acids, peptides and amines]
Statistics
?
PSSM-Id: 129446
View PSSM: TIGR00346
Aligned: 3 rows
Threshold Bit Score: 296.349
Threshold Setting Gi: 3123102
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P44302  16 AAKATFPYSVPMIAGFLFLGIAYGIYMKALGFGFLYPTLMALLIYAGSVEFIAAGALIAPFSPISVLLITLMISARQIFY 95  Haemophilus influenza...
O07942  28 AFRSAFPYTIPIFAGFLFLGIAYGIFMHSLGFSAIYPIIMSFMIFAGSMEFVAANFLLGAFNPMNALFLTLMVNARHLFY 107 Bacillus subtilis sub...
O25889   7 AFKDAFPHTISILLGYLLMGMTFGMLLVQQGYDYKVALFMSLFIYAGAVQFVAITLLSAQASLMNVVIVSLLVNARQTCY 86  Helicobacter pylori 2...
P44302  96 GISMLEKYgIHIGKKRWYLITTLVDESFSLNYMAKIPPHLDKGWYMFFVSLYLHIYWVLGAAMGNLFGTVLPFNLKGVEF 175 Haemophilus influenza...
O07942 108 GISMLDKY-RGTGKKKLYLIFGMCDESFSINYTANVPANVDKGWFMFFVTLLNHLYWVAGAAIGGIFGSYVKFNTEGLDF 186 Bacillus subtilis sub...
O25889  87 ALSMLDRF-KNTKWRLPYLAHALTDETFALLNLYAPKEGVSEKDFIFSISLLNHSYWIFGSLVGSLVGSHFSFDTQGMEF 165 Helicobacter pylori 2...
P44302 176 SMTALFLVIFAENWLKGKSHESSLLGLGIALVFLLIIGKEYFLIPTLIGIWLILTMRITKLE 237 Haemophilus influenzae Rd KW20
O07942 187 VMTALFIVIFIEQWMKEKKHYSALTGLGLSVASLILFGGNQFIIPAMLAILGVLTVLRKPLE 248 Bacillus subtilis subsp. subtilis str. 168
O25889 166 VMTAIFIVLFMEQYKRTTNHKNAWLGIVIAVVCLALFGTEYFLLIALVLMVLALMLFRKQLE 227 Helicobacter pylori 26695
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap