2NV2,3FEM


Conserved Protein Domain Family
TIGR00343

?
TIGR00343: TIGR00343 
Click on image for an interactive view with Cn3D
pyridoxal 5'-phosphate synthase, synthase subunit Pdx1
This protein had been believed to be a singlet oxygen resistance protein. Subsequent work showed that it is a protein of pyridoxine (vitamin B6) biosynthesis, and that pyridoxine quenches the highly toxic singlet form of oxygen produced by light in the presence of certain chemicals. [Biosynthesis of cofactors, prosthetic groups, and carriers, Pyridoxine]
Statistics
?
PSSM-Id: 129443
View PSSM: TIGR00343
Aligned: 8 rows
Threshold Bit Score: 477.725
Threshold Setting Gi: 3123067
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2NV2_A   9 VKRGMAEMQKGGVIMDVINAEQAKIAEEAGAVAVMALERVPADIRAAGGVARMADPTIVEEVMNAVSIPVMAKARIGHIV 88  Bacillus subtilis
O29742  15 IKRGFAKMQKGGVIMDVTNAEQAAIAEEAGAVAVMALHKVPADIRAAGGVARMADPKKIQEIIDAVTIPVMAKCRIGHIA 94  Archaeoglobus fulgidu...
O26762   8 LKKGFAKMTKGGVIMDVVNAEQAAIAEDSGAVAVMALEKVPADIRASGGVARMADPNKVQEIMDAVSIPVMAKVRIGHFV 87  Methanothermobacter t...
P45293   8 LNKNLAQMLKGGVIMDVQNPEQARIAEAAGAAAVMALERIPADIRAVGGVSRMSDPKMIKEIQGAVSIPVMAKVRIGHFV 87  Haemophilus influenza...
Q03148   8 IKSGLAQMLKGGVIMDVVTPEQAKIAEKSGACAVMALESIPADMRKSGKVCRMSDPKMIKDIMNSVSIPVMAKVRIGHFV 87  Saccharomyces cerevis...
P53824   6 VKTGLAQMLKGGVIMDVVTPEQAIIAERAGACAVMALERIPADMRKSGQVCRMSDPRMIKEIMEAVSIPVMAKVRIGHFV 85  Saccharomyces cerevis...
Q58090   8 LKKGFAKMVKHGVVMDVTNVEQAQIAEEAGAVAVMALERVPADIRAAGGVARMSDPALIEEIMDAVSIPVMAKCRIGHTT 87  Methanocaldococcus ja...
3FEM_A   8 IKSGLAQMLKGGVIMDVVTPEQAKIAEKSGACAVMALESIPADMRKSGKVCRMSDPKMIKDIMNSVSIPVMAKVRIGHFV 87  Saccharomyces cerevis...
2NV2_A  89 EARVLEAMGVDYIDESEVLTPADEEFHLNKNEYTVPFVCGCRDLGEATRRIAEGASMLRTKGEPGTGNIVEAVRHMRKVN 168 Bacillus subtilis
O29742  95 EARALEALGVDMIDESEVLTPADVFFHIDKRKFVVPFVCGARSLGEAVRRIWEGAAMIRTKGEAGTGNVVEAVKHMRLIN 174 Archaeoglobus fulgidu...
O26762  88 EAQVLEALGVDMIDESEVLTPADERFHIDKKKFTVPFVCGARNLGEALRRIDEGAAMIRTKGEPGTGNIVEAVRHMRIMM 167 Methanothermobacter t...
P45293  88 EAQILEAIEIDYIDESEVLSPADNRFHVDKKEFQVPFVCGAKDLGEALRRIAEGASMIRTKGEPGTGDIVQAVRHMRMMS 167 Haemophilus influenza...
Q03148  88 EAQIIEALEVDYIDESEVLTPADWTHHIEKDKFKVPFVCGAKDLGEALRRINEGAAMIRTKGEAGTGDVSEAVKHIRRIT 167 Saccharomyces cerevis...
P53824  86 EAQILEELQVDYIDESEVLTPADWTHHIEKHNFKVPFVCGAKDLGEALRRINEGAAMIRTKGEAGTGDVSEAVKHITKIK 165 Saccharomyces cerevis...
Q58090  88 EALVLEAIGVDMIDESEVLTQADPFFHIYKKKFNVPFVCGARNLGEAVRRIWEGAAMIRTKGEAGTGNIVEAVRHMRLMN 167 Methanocaldococcus ja...
3FEM_A  88 EAQIIEALEVDYIDESEVLTPADWTHHIEKDKFKVPFVCGAKDLGEALRRINEGAAMIRTKGEAGTGDVSEAVKHIRRIT 167 Saccharomyces cerevis...
2NV2_A 169 AQVRKVVAMSE-DE------------------------LMTEAKn-------------LGAPYELLLQIKKDGKLPVVNF 210 Bacillus subtilis
O29742 175 RAIFELQKMNE-ERiygvaekyasryaelasrvreemgLESVSRndvvfee-ytlgeiIDGIYEILLEIRELGRLPVVNF 252 Archaeoglobus fulgidu...
O26762 168 SEIREIQNK---EEe-----------------------ELWEVSr------------kIEAPLELVRETAKLGKLPVVNF 209 Methanothermobacter t...
P45293 168 QEIRRIQN-LR-EDe-----------------------LYVAAKd-------------LQVPVELVQYVHKHGKLPVVNF 209 Haemophilus influenza...
Q03148 168 EEIKACQQ-LKsEDd-----------------------IAKVAEe-------------MRVPVSLLKDVLEKGKLPVVNF 210 Saccharomyces cerevis...
P53824 166 AEIQQYKENLKtESd-----------------------FAAKATe-------------LRVPVDLLKTTLSEGKLPVVNF 209 Saccharomyces cerevis...
Q58090 168 EAIAQLQRMTD-EEvygvakfyanryaelaktvregmgLPATVLenepiyegftlaeiIDGLYEVLLEVKKLGRLPVVNF 246 Methanocaldococcus ja...
3FEM_A 168 EEIKACQQLKS-EDd-----------------------IAKVAEe-------------MRVPVSLLKDVLEKGKLPVVNF 210 Saccharomyces cerevis...
2NV2_A 211 AAGGVATPADAALMMQLGADGVFVGSGIFKSDNPAKFAKAIVEATTHFTDYKLIAELSKELGTAMKGIEISNLLPEQ--- 287 Bacillus subtilis
O29742 253 AAGGVATPADAALMMQLGADGVFVGSGIFKSSNPPEYAKAIVEAVQHYDEPEVVAEVSKGLGEAMKGLDVFKLSEDE--- 329 Archaeoglobus fulgidu...
O26762 210 AAGGVATPADAALMMQLGADGVFVGSGIFKSDNPEGYARAIVEATAHYDDPEVIAEVSRGLGTAMRGLEISEIPEEG--- 286 Methanothermobacter t...
P45293 210 AAGGIATPADAALMMQLGAEGVFVGSGIFKSGDPIKRASAIVKAVTNYRNPQILAQISEDLGEAMVGINENEIQILMaer 289 Haemophilus influenza...
Q03148 211 AAGGVATPADAALLMQLGCDGVFVGSGIFKSSNPVRLATAVVEATTHFDNPSKLLEVSSDLGELMGGVSIESISHASng- 289 Saccharomyces cerevis...
P53824 210 AAGGVATPADAALLMQLGCEGVFVGSGIFKSSDPEKLACAIVEATTHYDNPAKLLQISSDLGDLMGGISIQSINEAGgkn 289 Saccharomyces cerevis...
Q58090 247 AAGGVATPADAALMMQLGSDGVFVGSGIFKSENPLERARAIVEATYNYDKPDIVAEVSKNLGEAMKGIDITQISEAE--- 323 Methanocaldococcus ja...
3FEM_A 211 AAGGVATPADAALLMQLGCDGVFVGSGIFKSSNPVRLATAVVEATTHFDNPSKLLEVSSDLGELMGGVSIESISHASng- 289 Saccharomyces cerevis...
2NV2_A 288 --RMQERGW 294 Bacillus subtilis
O29742 330 --RLQTRGL 336 Archaeoglobus fulgidus DSM 4304
O26762 287 --RMQDRGW 293 Methanothermobacter thermautotrophicus str. Delta H
P45293 290 gk------- 291 Haemophilus influenzae Rd KW20
Q03148 290 -vRLSEIGW 297 Saccharomyces cerevisiae S288c
P53824 290 gaRLSEIGW 298 Saccharomyces cerevisiae S288c
Q58090 324 --KMQYRGD 330 Methanocaldococcus jannaschii DSM 2661
3FEM_A 290 -vRLSEIGW 297 Saccharomyces cerevisiae S288c
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap