1ORO,2PRY


Conserved Protein Domain Family
pyrE

?
TIGR00336: pyrE 
Click on image for an interactive view with Cn3D
orotate phosphoribosyltransferase
Orotate phosphoribosyltransferase (OPRTase) is involved in the biosynthesis of pyrimidine nucleotides. Alpha-D-ribosyldiphosphate 5-phosphate (PRPP) and orotate are utilized to form pyrophosphate and orotidine 5'-monophosphate (OMP) in the presence of divalent cations, preferably Mg2+. In a number of eukaryotes, this protein is fused to a domain that catalyses the reaction (EC 4.1.1.23). The combined activity of EC 2.4.2.10 and EC 4.1.1.23 is termed uridine 5'-monophosphate synthase. The conserved Lys (K) residue at position 101 of the seed alignment has been proposed as the active site for the enzyme. [Purines, pyrimidines, nucleosides, and nucleotides, Pyrimidine ribonucleotide biosynthesis]
Statistics
?
PSSM-Id: 129436
View PSSM: TIGR00336
Aligned: 11 rows
Threshold Bit Score: 175.309
Threshold Setting Gi: 3914508
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1ORO_A        10 EFALSKQVLKF--GE-FTLKSGRKSPYFFNAGLFNTGRDLALLGRFYAEALVDSGI-EFDLLFGPAYKGIPIATTTAVAL 85  Escherichia col...
P43855        10 EFALSRNVLKF--GE-FTLKSGRKSPYFFNAGLFNTGADLARLGEFYAAAIQASAV-DFDVVFGPAYKGIPIGTSVSVAL 85  Haemophilus inf...
P30402        17 ELGLECKALRF--GS-FKLNSGRQSPYFFNLSLFNSGKLLANLATAYATAIIQSEL-KFDVIFGPAYKGIPLAAIVCVKL 92  Saccharomyces c...
O27888        15 ELLSEMDVVQR--GK-FILSSGRESDYYVDIKRAVTEPAVLDVIARLIADAAG----EVDRIAGPALGAVPIATAVSLYS 87  Methanothermoba...
Q58509         9 NLLKEVGCIRF--GE-FILASGKKSNYYIDIKKATTNPEILKLVGEIIAEQIKD---EDVKVAGVELGSVPIATAVSIIA 82  Methanocaldococ...
O28533        10 KRMIEVGALKF--GD-FVLSSGKRSRVYVDVKLASTFPDILEMISEGMAAKLKD-L-EFDRIACVELGGVPIAVALSLKM 84  Archaeoglobus f...
Q55574        22 LHLLATHAYKE--GD-FILSSGQPSTYYINGKLVTLRAEGALAIGRLLLTELPD---QVEAVAGLTLGADPIVSAVSTVS 95  Synechocystis s...
P25972        13 KHLLDIQAVFLrpNEpFTWASGILSPIYCDNRLTLSFPEVRNDVASGISKLVKEHFpEAEMIAGTATAGIPHAALAADHL 92  Bacillus subtil...
WP_000806175  10 EFALSKQVLKF--GE-FTLKSGRKSPYFFNAGLFNTGRDLALLGRFYAEALVDSGI-EFDLLFGPAYKGIPIATTTAVAL 85  Escherichia
P13298        14 ELAIECQALRF--GS-FKLKSGRESPYFFNLGLFNTGKLLSNLATAYAIAIIQSDL-KFDVIFGPAYKGIPLAAIVCVKL 89  Saccharomyces c...
2PRY_A        14 ELAIECQALRF--GS-FKLKSGRESPYFFNLGLFNTGKLLSNLATAYAIAIIQSDL-KFDVIFGPAYKGIPLAAIVCVKL 89  Saccharomyces c...
1ORO_A        86 AEHHDl---DLPYCFNRKEAKDHGEGGNLVG-SALQG-RVMLVDDVITAGTAIRESMEIIQANGATLAGVLISLDRQERg 160 Escherichia col...
P43855        86 FNRYGi---DKPVCFNRKEVKDHGEGGNLIG-SPLQG-KILLVDDVITAGTAIRESMELISANQAELAAVLIALNRKERg 160 Haemophilus inf...
P30402        93 AEIGGtkfqGIQYAFNRKKVKDHGEGGIIVG-ASLEDkRVLIIDDVMTAGTAINEAFEIISIAQGRVVGCIVALDRQEVi 171 Saccharomyces c...
O27888        88 RKP---------LLMIRKEKKGYGTSKLIEG-DLQKGdRVAVVEDVTTTGGSLLKAVRAIQENGGIVEKAFVIVDREE-- 155 Methanothermoba...
Q58509        83 QKP---------LLIVRKKPKDYGTKNKIEG-ELKEGdKVVIVEDVTTTGGSVLKAVKEIRENGGIVDKVFVVVDRLE-- 150 Methanocaldococ...
O28533        85 KKP---------LVIFRKEKKDYGIKGDRIG-EVKEGeKVVVVEDVITTGSSALSAARRVEESGASVAAIIAVVDREE-- 152 Archaeoglobus f...
Q55574        96 AYEEK----PVVALIIRKEAKGHGTKAYIEGpELAPGtKVVVLEDVVTTGKSAMLAVERLRNAGYQVDTVISLVDRQQ-- 169 Synechocystis s...
P25972        93 NLP---------MCYVRSKPKAHGKGNQIEG-AVQEGqKTVVIEDLISTGGSVLEACAALQAAGCEVLGVVSIFTYGLP- 161 Bacillus subtil...
WP_000806175  86 AEHHDl---DLPYCFNRKEAKDHGEGGNLVG-SALQG-RVMLVDDVITAGTAIRESMEIIQANGATLAGVLISLDRQERg 160 Escherichia
P13298        90 AEIGGskfqNIQYAFNRKEAKDHGEGGIIVG-SALENkRILIIDDVMTAGTAINEAFEIISNAKGQVVGSIIALDRQEVv 168 Saccharomyces c...
2PRY_A        90 AEIGGskfqNIQYAFNRKEAKDHGEGGIIVG-SALENkRILIIDDVMTAGTAINEAFEIISNAKGQVVGSIIALDRQEVv 168 Saccharomyces c...
1ORO_A       161 rg----eiSAIQEVERDYNCKVISIITLKDL 187 Escherichia coli BW2952
P43855       161 kg----elSAIQEVERDYQCQVLSIIDLDDL 187 Haemophilus influenzae Rd KW20
P30402       172 hesdpertSATQSVSKRYNVPVLSIVSLTQV 202 Saccharomyces cerevisiae S288c
O27888       156 --------GAVDEFKRE-GITLIPLLSVSDF 177 Methanothermobacter thermautotrophicus str. Delta H
Q58509       151 --------GAKENLQKE-NVELIPLVTVKEL 172 Methanocaldococcus jannaschii DSM 2661
O28533       153 ---------SGRNFMSL--LKLSDLIEAHDS 172 Archaeoglobus fulgidus DSM 4304
Q55574       170 ---------GGREFYQSQGLTFQALFTIGDI 191 Synechocystis sp. PCC 6803 substr. Kazusa
P25972       162 --------KAEEAFAKA-ELPYYSLTDYDTL 183 Bacillus subtilis subsp. subtilis str. 168
WP_000806175 161 rg----eiSAIQEVERDYNCKVISIITLKDL 187 Escherichia
P13298       169 stddkeglSATQTVSKKYGIPVLSIVSLIHI 199 Saccharomyces cerevisiae S288c
2PRY_A       169 stddkeglSATQTVSKKYGIPVLSIVSLIHI 199 Saccharomyces cerevisiae S288c
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap