1NI9


Conserved Protein Domain Family
glpX

?
TIGR00330: glpX 
Click on image for an interactive view with Cn3D
fructose-1,6-bisphosphatase, class II
This model represents GlpX, one of three classes of bacterial fructose-1,6-bisphosphatases. This form is homodimeric and Mn2+-dependent, and only very distantly related to the class I fructose-1,6-bisphosphatase, the product of the fbp gene, which is homotetrameric and Mg2+-dependent. A third class is found as one of two types in Bacillus subtilis. In E. coli, GlpX is found in the glpFKX operon together with a glycerol update protein and glycerol kinase. [Energy metabolism, Pentose phosphate pathway]
Statistics
?
PSSM-Id: 129430
View PSSM: TIGR00330
Aligned: 5 rows
Threshold Bit Score: 510.148
Threshold Setting Gi: 418587
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1NI9_A   4 RRELAIEFSRVTESAALAGYKWLGRGDKNTADGAAVNAMRIMLNQVNIDGTIVIGEGEIDEAPMLYIGEKVGTGRGDAVD 83  Escherichia coli
P28860   2 RRELAIEFSRVTESAALAGYKWLGRGDKNTADGAAVNAMRIMLNQVNIDGTIVIGEGEIDEAPMLYIGEKVGTGRGDAVD 81  Escherichia coli
P44811   2 NRALAIEFSRVTEAAALAAYTWLGRGDKNAADDAAVKAMRYMLNLIHMDAEIVIGEGEIDEAPMLYVGEKVGSGLGELVS 81  Haemophilus influenza...
Q03224   2 ERSLSMELVRVTEAAALASARWMGRGKKDEADEAATSAMRDVFDTVPMKGTVVIGEGEMDEAPMLYIGEKLGNGYGPRVD 81  Bacillus subtilis sub...
P21437   1 MMSLAWPLFRVTEQAALAAWPQTGCGDKNKIDGLAVTAMRQALNDVAFRGRVVIGEGEIDHAPMLWIGEEVGKGDGPEVD 80  Escherichia coli K-12
1NI9_A  84 IAVDPIEGTRMTAMGQANALAVLAVGDKGCFLNAPDMYMEKLIVGPGAKGTIDLNLPLADNLRNVAAALGKPLSELTVTI 163 Escherichia coli
P28860  82 IAVDPIEGTRMTAMGQANALAVLAVGDKGCFLNAPDMYMEKLIVGPGAKGTIDLNLPLADNLRNVAAALGKPLSELTVTI 161 Escherichia coli
P44811  82 IAVDPIDGTHMTAMGQSNAISVLAAGGKNTFLKAPDMYMEKLVVGSNVKGIIDLNLPLEQNLRRIASKLGKSLSDLTVMV 161 Haemophilus influenza...
Q03224  82 VAVDPLEGTNILASGGWNALTVIAVADHGTLLNAPDMYMQKIAVGPEAVGCIDIEAPVIDNLKAVAKAKNKDVEDVVATI 161 Bacillus subtilis sub...
P21437  81 IAVDPIEGTRMVAMGQSNALAVMAFAPRDSLLHAPDMYMKKLVVNRLAAGAIDLSLPLTDNLRNVAKALGKPLDKLRMVT 160 Escherichia coli K-12
1NI9_A 164 LAKPRHDAVIAEMQQLGVRVFAIPDGDVAASILTCMPDSEVDVLYGIGGAPEGVVSAAVIRALDGDMNGRLLARHDVKGD 243 Escherichia coli
P28860 162 LAKPRHDAVIAEMQQLGVRVFAIPDGDVAASILTCMPDSEVDVLYGIGGAPEGVVSAAVIRALDGDMNGRLLARHDVKGD 241 Escherichia coli
P44811 162 LAKPRHDAVIKQIHNLGAKVLAIPDGDVAGSVLCCLPDAEVDLLYGIGGAPEGVAAAAAIRALGGDMQARLIPRNEVKSD 241 Haemophilus influenza...
Q03224 162 LNRERHAKIISELREAGARIKLINDGDVAGAINTAFDHTGVDILFGSGGAPEGVLSAVALKALGGEIIGKLLPQ------ 235 Bacillus subtilis sub...
P21437 161 LDKPRLSAAIEEATQLGVKVFALPDGDVAASVLTCWQDNPYDVMYTIGGAPEGVISACAVKALGGDMQAELIDFCQAKGD 240 Escherichia coli K-12
1NI9_A 244 NEENRRIGEQELARCKAMGIEAGKVLRLGDMARSDNVIFSATGITKGDLLEGISRKGNIATTETLLIRGKSRTIRRIQSI 323 Escherichia coli
P28860 242 NEENRRIGEQELARCKAMGIEAGKVLRLGDMARSDNVIFSATGITKGDLLEGISRKGNIATTETLLIRGKSRTIRRIQSI 321 Escherichia coli
P44811 242 TEENKKIAANEIQRCAALGVKVNEVLKLEDLVRDDNLVFTATGITNGDLLKGISRKGNLASTETILIRGKSRTIRKIQSI 321 Haemophilus influenza...
Q03224 236 -------SEEEITRCHKMGLDLSKVLRMEDLVKGDDAIFAATGVTDGELLKGVQFKGSVGTTESLVIRAKSGTVRFVDGR 308 Bacillus subtilis sub...
P21437 241 YTENRQIAEQERKRCKAMGVDVNRVYSLDELVRGNDILFSATGVTGGELVNGIQQTANGVRTQTLLIGGADQTCNIIDSL 320 Escherichia coli K-12
1NI9_A 324 H 324 Escherichia coli
P28860 322 H 322 Escherichia coli
P44811 322 H 322 Haemophilus influenzae Rd KW20
Q03224 309 H 309 Bacillus subtilis subsp. subtilis str. 168
P21437 321 H 321 Escherichia coli K-12
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap