Conserved Protein Domain Family
flhB

?
TIGR00328: flhB 
flagellar biosynthetic protein FlhB
FlhB and its functionally equivalent orthologs, from among a larger superfamily of proteins involved in type III protein export systems, are specifically involved in flagellar protein export. The seed members are restricted and the trusted cutoff is set high such that the proteins gathered by this model play roles specifically related to flagellar structures. Full-length homologs scoring below the trusted cutoff are involved in peptide export but not necessarily in the creation of flagella. [Cellular processes, Chemotaxis and motility]
Statistics
?
PSSM-Id: 129428
View PSSM: TIGR00328
Aligned: 16 rows
Threshold Bit Score: 412.814
Threshold Setting Gi: 499221421
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P76299         7 DKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVSVIWFGG-VSLARRLSGMLSAGLHFDHSIINDPNLILGQIILLI 85  Escherichia col...
P56416         5 EKTELPSAKKIQKAREEGNVPKSMEVVGVLGLLAGLISIFVFF-IWWVDGFSEMYRHVLK-DFSLDFSKESVQELFNQLA 82  Helicobacter py...
AAC32325       9 EKTEEPTQKRREQAREDGSIVTSKEVFVFATLAGG-LALLMMI-EGLLPALVRGWSGYLVIEPGADLERIAMVR-LGQAW 85  Rhodobacter sph...
O54243         9 SKTEAPSEKKISDATEKGNVPFSREVTAFASTLAIYIFVVFFLsDGAANMAEALKDIFEQPEAWRLDTATDAVALISHVV 88  Sinorhizobium m...
O83710        26 GRSEDPTETKLRKAREEGRVPKSQDLNGAFVMLFTSTSLFLLApFILRECIGVLRFFFTRATTASIQNT----GWFFVFV 101 Treponema palli...
Q44760        24 GRTELPTDQKKQKAREEGRVLKSTEINTAVSLLLLFALFFFMLsYFALDLIAVFKEQAIKLPEVMRMSVY---TMGFAYI 100 Borrelia burgdo...
WP_011711714   8 SKTEEPTSKRLSDSRNKGQVVSSKEVPTALLMLAALAVFLVQG-NELWQALQRKMHFFLSGQISDDITPTGVSLIFNEII 86  Magnetococcus m...
WP_010898592  15 EKTEKATPKKRQDSRKKGQVAKSTDVNTAIILLCVFLFLWLFGgPLLGGTLEKLLIHTFESYLLMDVTEESVAELMFEIT 94  Bacillus halodu...
WP_000840982   8 ERTEEATPRRLQQAKEKGQVARSKELASVSVLVVGAVSLMWFG-EILAKGLMVAMQRLFELSREEIFDLGKLFDIIGGSL 86  Vibrio cholerae
WP_010965447 263 DKTEEATPKRKSEARKKGQVARSKEVPLAATLVAITFIISLGGqTFFNGLGVMMQTFFQSYIHSNLTEL-DLRRIIIFVI 341 Clostridium ace...
P76299        86 REAMLALLPLISGVVLVALISPVML-GGLVFSGKSLQPKFSKLNP--LPGIKR-MFSAQTGAELLKAILKTILVGSVTGF 161 Escherichia col...
P56416        83 KDTFLLLLPILIILVVVAFLSNVLQ-FGWLFAPKVIEPKFSKINP--INGVKN-LFSLKKLLDGSLITLKVFLAFFLGFF 158 Helicobacter py...
AAC32325      86 REVLIAGLVVSVPLLALVLLVQSAM-GGINFSTKALSFKASRINP--AAGLKR-MVSLKALVELAKAVAKVALLIGVAVL 161 Rhodobacter sph...
O54243        89 LKCAALVLPVFILLILFGVGSSIFQ-NLPRPVLDRIQPKWNRVSP--AAGFKR-IYGVQGLVEFGKSLFKIIVVSIVVVL 164 Sinorhizobium m...
O83710       102 RYFMKLALPISFVALVSGVAANIVQnKTVLFSVKSIRPQFKKISPdvIRFFKRsFFSTEGLFNLLKSLIKITAIFFVSYF 181 Treponema palli...
Q44760       101 RSIMGYVVLFFFASLAVNFFVNIIQ-VGFFITFKSLEPRWDKISFnfSRWAKNsFFSAGAFFNLFKSLLKVVIICLIYYF 179 Borrelia burgdo...
WP_011711714  87 RAVVMDLAPFFALFLVVAIISGLIQ-HGWLITFEPLMPKFSKVNP--LQGLKR-LFSVRSLVEAFKSIVKIFVISFAVYL 162 Magnetococcus m...
WP_010898592  95 MEAAIVLLPIMAIALIAGVLASYIQ-VGPLFTTEPLKMKLSKIDP--IKGAKR-IFSVRALVEFLKSLLKIVLTGLAAFS 170 Bacillus halodu...
WP_000840982  87 VNLLLPLLMILSTLFIAALIGAAGV-GGISFSAEAAMPKLSKMNP--LSGLKR-MFGMQSWVELLKSILKVLLVSGVAFY 162 Vibrio cholerae
WP_010965447 342 LNAGKFIFMFGVPVMVVGIVANIAQ-TGWITTTEPIKPDLKKLNP--ISGFKR-IFSMTTIVNLLKDLVVVAVLSVVGYK 417 Clostridium ace...
P76299       162 FLWHHWPQMMRLMAESPITAMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDPHVKG 241 Escherichia col...
P56416       159 IFSLFLGELNHAALLNLQGQLLWFKNKALWLISSLLFLFFVLAFIDLAIKRRQYTNSLKMTKQEVKDEYKQQEGNPEIKA 238 Helicobacter py...
AAC32325     162 VLRDELSPLDRLWTAAPGDAAAVLGAGLIRLVSALLIVLAVIGGLDLVWQAWSLTNSMKMSRQELKEESKESNGSPEVKG 241 Rhodobacter sph...
O54243       165 VLWNDYFATLDMMFSDPVTIFTTMISDLKQIIIVVLFATATLAIVDLFWTRHHWYTELRMTRQEVKDELKQSQGDPIVKS 244 Sinorhizobium m...
O83710       182 TIRNDLFMFVSLLGVSLTQSIFYITSLAGKVLLEVSLLLVVFSLPDYFFQRRQFIDSLKMSRQEVKEELKEQEGDPLVRS 261 Treponema palli...
Q44760       180 IIENNIGKISKLSEYTLQSGISIVLVIAYKICFFSVMFLAIVGVFDYLFQRSQYIESLKMTKEEVKQERKEMEGDPLLRS 259 Borrelia burgdo...
WP_011711714 163 AMRNNIDQILGLADTTITEFTTLMFKDSLEILWRVTLAFLLIAVLDFIYQKFDYIKGLRMSKQEIKDEMKQMEGDPLLKG 242 Magnetococcus m...
WP_010898592 171 IVWFSLEDVMLLSQKSVENSFVTVAQLTALLGILIAILLLILSIPDYLYQRYDHEKQIRMSKQDVKDEHKNVEGDPKVKS 250 Bacillus halodu...
WP_000840982 163 LIEASQKDLFQLSLDVYPQNIFHALDILLNFVLLISCSLLVVVAIDIPFQIWQHAEQLKMTKQEVKDEYKDTEGKPEVKG 242 Vibrio cholerae
WP_010965447 418 FLMSNYGDIANLNNLMVQYIPQAYLSYVISIFRIVALIMIVIAGFDFVYNRYKYKKDMKMTKHEVKEEFKQAEGDPEIKG 497 Clostridium ace...
P76299       242 RIRQMQRAAAR-----RRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVALRIREIGAENNVPTLEAPP 316 Escherichia col...
P56416       239 KIRQMMLKNAT-----NKMMQEIPKANVVVTNPTHYAVALKFDEEH-PVPVVVAKGTDYLAIRIKGIAREHDIEIIENKT 312 Helicobacter py...
AAC32325     242 RMRRMQMEASRngarrRAALDDVPQATAIVTNPTHFAVALRYVPGETPAPVILAMGKGPMALDIIERGRKAGVGTVRIPL 321 Rhodobacter sph...
O54243       245 RLRSMQRDRAR-----KRMISSVPRATLIIANPTHYAVALRYVREESDAPVVVAMGKDLVALKIREIAEKNGIPVFEDPP 319 Sinorhizobium m...
O83710       262 YVRKQMQSLVR-----ES-ARNTTDADVVITNPTHFAVAVQYEPAYMTAPTVVAKGSDGTAYRIKRLAKEAGILIEENKP 335 Treponema palli...
Q44760       260 RIKERMRVILS-----TNLRVAIPQADVVITNPEHFAVAIKWDSETMLAPKVLAKGQDEIALTIKKIARENNVPLMENKL 334 Borrelia burgdo...
WP_011711714 243 RIRQIQRELAQ-----SRMMQEVPKADVIITNPTHYACALQYTPGQMSAPKLVAKGKGLIAARIRELADENNIPRVENPP 317 Magnetococcus m...
WP_010898592 251 KRKQKQMEMAM-----QRMMQEVPKADVVITNPTHYAIALKYDQSKMDAPVIVAKGVDYVAFKIKSLAKQHNVVTVENKP 325 Bacillus halodu...
WP_000840982 243 RIRMLQREAAQ-----RRMMAALPQADVIITNPEHFSVALRYKQNTDKAPVVIAKGVDHMALKIREIAREYDIAIVPAPP 317 Vibrio cholerae
WP_010965447 498 KRRQRMREIVT-----RTMLSKVPDATVVITNPTHISVAIKYERGVDKAPTVVAKGADRTALRIKEIAKENNVPIMENKP 572 Clostridium ace...
P76299       317 LARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLKRWR 353 Escherichia coli K-12
P56416       313 LARELYRDVKLNAAIPEELFEAVAIVFAQVAKLEQER 349 Helicobacter pylori 26695
AAC32325     322 LARALYFTGDIGQEIPDGLDGAVAVVLAHVYRLDRGE 358 Rhodobacter sphaeroides
O54243       320 LARSMFAQVSVDSVIPPVFYKAVAELIHRVYAAQPQQ 356 Sinorhizobium meliloti 1021
O83710       336 LARALYTQVAIGREVPYEYFNALVLIFTKLDKFKTHa 372 Treponema pallidum subsp. pallidum str. Nichols
Q44760       335 LARALYANVKVNEEIPREYWEIVSKILVRVYSITKKf 371 Borrelia burgdorferi B31
WP_011711714 318 LARTLYRDVELEQFIPPELFKAVAEVLAYVFSLKNRR 354 Magnetococcus marinus
WP_010898592 326 LARALYDQADIGDQVPEQLFKAVAEVLAYVYRLKKKQ 362 Bacillus halodurans
WP_000840982 318 LARALYHTTELEQQIPDGLFVAVAQVLAFVFQLKQYR 354 Vibrio cholerae
WP_010965447 573 LARLIFKKVEVDEQIPAEMYQTVAEILALVYKLNKKQ 609 Clostridium acetobutylicum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap