Conserved Protein Domain Family

TIGR00328: flhB 
flagellar biosynthetic protein FlhB
FlhB and its functionally equivalent orthologs, from among a larger superfamily of proteins involved in type III protein export systems, are specifically involved in flagellar protein export. The seed members are restricted and the trusted cutoff is set high such that the proteins gathered by this model play roles specifically related to flagellar structures. Full-length homologs scoring below the trusted cutoff are involved in peptide export but not necessarily in the creation of flagella. [Cellular processes, Chemotaxis and motility]
PSSM-Id: 129428
Aligned: 16 rows
Threshold Bit Score: 412.814
Threshold Setting Gi: 499221421
Created: 7-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
P76299       317 LARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLKRWR 353 Escherichia coli K-12
P56416       313 LARELYRDVKLNAAIPEELFEAVAIVFAQVAKLEQER 349 Helicobacter pylori 26695
AAC32325     322 LARALYFTGDIGQEIPDGLDGAVAVVLAHVYRLDRGE 358 Rhodobacter sphaeroides
O54243       320 LARSMFAQVSVDSVIPPVFYKAVAELIHRVYAAQPQQ 356 Sinorhizobium meliloti 1021
O83710       336 LARALYTQVAIGREVPYEYFNALVLIFTKLDKFKTHa 372 Treponema pallidum subsp. pallidum str. Nichols
Q44760       335 LARALYANVKVNEEIPREYWEIVSKILVRVYSITKKf 371 Borrelia burgdorferi B31
WP_011711714 318 LARTLYRDVELEQFIPPELFKAVAEVLAYVFSLKNRR 354 Magnetococcus marinus
WP_010965447 573 LARLIFKKVEVDEQIPAEMYQTVAEILALVYKLNKKQ 609 Clostridium acetobutylicum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap