1A79,1RLV


Conserved Protein Domain Family
endA

?
TIGR00324: endA 
Click on image for an interactive view with Cn3D
tRNA-intron lyase
The enzyme catalyses the endonucleolytic cleavage of pre tRNA at the 5' and 3' splice sites to release the intron and produces two half tRNA molecules bearing 5' hydroxyl and 2', 3'-cyclic phosphate termini. The genes are homologous in Eucarya and Archea. The two yeast genes have been functionally studied and are two subunits of a heterotetramer enzyme in yeast the other two subunits of which have no known homologs. [Transcription, RNA processing]
Statistics
?
PSSM-Id: 129424
View PSSM: TIGR00324
Aligned: 7 rows
Threshold Bit Score: 166.107
Threshold Setting Gi: 40889677
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1A79_A   1 KITGLLD----GDRVIVFDKNGIS--KLSAR-HYGNVEGNFLSLSLVEALYLINLG----WLEVKYKDNKPLSFEE-LYE 68  Methanocaldococcus ja...
Q58819   9 KITGLLD----GDRVIVFDKNGIS--KLSAR-HYGNVEGNFLSLSLVEALYLINLG----WLEVKYKDNKPLSFEE-LYE 76  Methanocaldococcus ja...
O07165   2 RVEGQL-----GDEVVTIKATSIAr-RLHGKsHYGKMYEDRLQLSLIEAAYLMERG----KLKLMKDDDE-VSPEE-FIS 69  Methanothermobacter t...
O29362 148 EIAGIL-----SDEYVITKQTEIF-----SRyFYGSEKGDLVTLSLIESLYLLDLG----KLNLLNADRE----E--LVK 207 Archaeoglobus fulgidu...
P16658 171 ESLRKFKlkqtEDVGIVAQQQDIS--ESNLRdEDNNLLDENGDLLPLESLELMPVEamflTFALPVLDISPACLAGkLFQ 248 Saccharomyces cerevis...
P39707  94 EYQRKFK----KDEHIAKLKKIGRinDKTTAeELQRLDKSSNNDQLIESSLFIDIAntsmILRDIRSDSDSLSRDD-ISD 168 Saccharomyces cerevis...
1RLV_A 148 EIAGVL-----SDEYVITKQTEIF-----SRyFYGSEKGDLVTLSLIESLYLLDLG----KLNLLNAD-----REE-LVK 207 Archaeoglobus fulgidus
1A79_A  69 YARN--VEERLCLKYLVYKDLRTRGYIVKTGLKYGADFRLYERGA-NIDKEHSVYLVKVFPEDSSFLLSELTGFVRVAHS 145 Methanocaldococcus ja...
Q58819  77 YARN--VEERLCLKYLVYKDLRTRGYIVKTGLKYGADFRLYERGA-NIDKEHSVYLVKVFPEDSSFLLSELTGFVRVAHS 153 Methanocaldococcus ja...
O07165  70 LLG----ERGLYSKYLVYRDLRNRGYIVKTGFKYGAEFRLYERGG-APGRTHSAYLVRVISENDTIHALDFSSYVRVAHG 144 Methanothermobacter t...
O29362 208 RARE--VERNFDRRYEVYRNLKERGFVVKTGFKFGSEFRVYRKVEsVDDLPHSEYLVDIADSRE-IRLIDLARAVRLAQN 284 Archaeoglobus fulgidu...
P16658 249 FDAKykDIHSFVRSYVIYHHYRSHGWCVRSGIKFGCDYLLYKRGP---PFQHAEFCVMGLDHDVSKDYTWYSSIARVVGG 325 Saccharomyces cerevis...
P39707 169 LLFKqyRQAGKMQTYFLYKALRDQGYVLSPGGRFGGKFIAYPGDP-LRFHSHLTIQDAIDYHNEPIDLISMISGARLGTT 247 Saccharomyces cerevis...
1RLV_A 208 RARE--VERNFDRRYEVYRNLKERGFVVKTGFKFGSEFRVYRKVEsVDDLPHSEYLVDIADSRE-IRLIDLARAVRLAQN 284 Archaeoglobus fulgidus
1A79_A 146 VRKKLLIAIVDAD-GDI---------------------VYYNMTYV 169 Methanocaldococcus jannaschii
Q58819 154 VRKKLLIAIVDAD-GDI---------------------VYYNMTYV 177 Methanocaldococcus jannaschii DSM 2661
O07165 145 VNKKLLMAFLDDE-EDI---------------------TYYLVDWI 168 Methanothermobacter thermautotrophicus str. Delta H
O29362 285 VRKRMVFAYGKN---------------------------YLCFERV 303 Archaeoglobus fulgidus DSM 4304
P16658 326 AKKTFVLCYVERLiSEQeaialwksnnftklfnsfqvgEVLYKRWV 371 Saccharomyces cerevisiae S288c
P39707 248 VKKLWVIGGVAEEtKET---------------------HFFSIEWA 272 Saccharomyces cerevisiae S288c
1RLV_A 285 VRKRMVFAYGKN---------------------------YLCFERV 303 Archaeoglobus fulgidus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap