Conserved Protein Domain Family
cdhC

?
TIGR00316: cdhC 
CO dehydrogenase/CO-methylating acetyl-CoA synthase complex, beta subunit
Nomenclature follows the description for Methanosarcina thermophila. The CO-methylating acetyl-CoA synthase is considered the defining enzyme of the Wood-Ljungdahl pathway, used for acetate catabolism by sulfate reducing bacteria but for acetate biosynthesis by acetogenic bacteria such as oorella thermoacetica (f. Clostridium thermoaceticum). [Energy metabolism, Chemoautotrophy]
Statistics
?
PSSM-Id: 129416
View PSSM: TIGR00316
Aligned: 4 rows
Threshold Bit Score: 771.716
Threshold Setting Gi: 499180346
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_010877886  21 EEAEFPFDISPMYEGERIRKGDMYVELGGPTQPGFELVMalPMDQVEDmKVTLIGPDLDEMEEGQAYPYAMIYYIAGEMV 100 Archaeoglobus f...
WP_010869651   1 MFDDIPVSVGPMNEGERVRGPDMYVELAGPKSYGFELVK--VVNKAED-KVEIIGKDIDEMEEGSRNPFAIIVEVSGSNL 77  Methanocaldococ...
WP_010877318   1 MFEDIPVDVSPMHEGERIRSANMFVELAGPKSIGAELVQ--VKDEVEDgKVEVKGPEIDEMEQGQVYPFAINVEVAGSEL 78  Methanothermoba...
WP_010869647 294 vEFDIPVSVGPMNEGERVRGPDMYVELAGPKSYGFELVK--VVNKAED-KVEIIGKDIDEMEEGSRNPFAIIVEVSGSNL 370 Methanocaldococ...
WP_010877886 101 ETDLEPVIERRNHDFQNYIEGYMHLNQRYDIWIRIGKNAIKKGLKsLIQIAKATMMLYKNELPFIEKIEAVYITDKDLVE 180 Archaeoglobus f...
WP_010869651  78 EEDLEGVLERRIHEFLNYIEGVMHLNQRDQVWIRINKDSFNKGLR-LKHIGKVVQRLFKAEFPFIEKCDVTIITDPEKVK 156 Methanocaldococ...
WP_010877318  79 EEELESVIERRLHELCNYVKGFMHLNQRDQIWCRVSTEAKDAGFR-LEHLGKALSVLFREEFPIIESIAVTLMTDEAAVQ 157 Methanothermoba...
WP_010869647 371 EEDLEGVLERRIHEFLNYIEGVMHLNQRDQVWIRINKNSFNKGLR-LKHIGEVVKQLFKEHFPIVEKCNVIIITDPDKVK 449 Methanocaldococ...
WP_010877886 181 KLLnELAMPIFEERDARVEALSDEDVDEFYSCTLCQSFAPTNVCIVSPDRPSLCGAITWFDGRAAAKVDPEGPNRAVPKG 260 Archaeoglobus f...
WP_010869651 157 EEL-EKAREIYNKRDEKTKALHEEDVDVFYGCVMCQSFAPTHVCVITPDRPALCGGINYLDARAAAKIDPNGPIFEIPKG 235 Methanocaldococ...
WP_010877318 158 EFL-ETAREKYETRDSRARELSDEDVDVFYGCLMCQSFAPTHVCIVTPDRTALCGAINWFDCRAAYKMDPDGPIFEIEKG 236 Methanothermoba...
WP_010869647 450 EEL-EKAKEIYKKRDEKTKSIREEDVDVFYGCVMCQSFAPTHVCIITPDRPSLCGSINYLDARAAAKIDPNGPIFEIPKG 528 Methanocaldococ...
WP_010877886 261 ELLDPIGGEYSGVNEFAKQESGGEYERIKLHSFFEYPHTSCGCFEVIGFYMPEVDGIGWVHRGYAEPAPNGLTFSTMAGQ 340 Archaeoglobus f...
WP_010869651 236 ECLDEKLGIYSGVNEVVRERSQGTVEEVTLHSALEKPCTSCGCFEAIVFYIPEVDGFGIAHRGYKGETPMGIPFSTLAGQ 315 Methanocaldococ...
WP_010877318 237 EVLDPERGEYANVNAAVEENSQGTTDRVYLHSVFGYPHTSCGCFEAVAFYIPELDGIGIVNRDFRGETPLGIPFSAMAGQ 316 Methanothermoba...
WP_010869647 529 ECLDEKLGIYTGVNEVVRERSQGSVEEMALHSALTNPCTSCGCFEAIVFYIPEVDGFGVAHRNFRGETPFGLPFSTLAGQ 608 Methanocaldococ...
WP_010877886 341 TGGGKQVVGFLGIGIAYFRSKKFIQADGGWYRTVWMPKELKERVAKYIPDDIRDKIATEEDAKTLDELREFLKKVDHPVV 420 Archaeoglobus f...
WP_010869651 316 CSGGKQVPGFVGISISYMKSPKFLQGDGGWERVVWLPKELKERVKDAIPEELYDKIATEEDVKTTDELIKFLKEKGHPCA 395 Methanocaldococ...
WP_010877318 317 CSGGKQVEGFSGLSLEYMRSPKFLQADGGYHRVIWMPRELKESVLEFIPEDVRDKIATEEDATSIKDLRRFLRDNEHPVL 396 Methanothermoba...
WP_010869647 609 CSGGKQVPGFVGISISYMKSPKFLQGDGGWERVVWLPKELKERVKDAIPEELYDKIATEEDVKTTDELIKFLKEKGHPIV 688 Methanocaldococ...
WP_010877886 421 KGVVRPVDGKKItngwveeeeeeaeevaeeaaaeaapaaqpaqAAQPMAMQPMPMQMPgfQLPALQMPAASAA-PAGVKL 499 Archaeoglobus f...
WP_010869651 396 ERIGAEVEEEAI-------------------------------EEEEVEEEMEEVEGI--EVPTMTLPGTFAGlPPGIKI 442 Methanocaldococ...
WP_010877318 397 ERAAVEETEPEE-------------------------------EEVEEAYPEETPIPEgvPVMAAPEMTLPAA-G-GFRI 443 Methanothermoba...
WP_010869647 689 K-KTEEEVVEEV-------------------------------EEEKEEVKATEEEKEgiEVGELITKLAKEG---GIQI 733 Methanocaldococ...
WP_010877886 500 VIKDAKITIEKVII 513 Archaeoglobus fulgidus
WP_010869651 443 VLYNAVIKAEKIII 456 Methanocaldococcus jannaschii
WP_010877318 444 VLKNAKIYAEKVII 457 Methanothermobacter thermautotrophicus
WP_010869647 734 IMKNVKIVInlnvk 747 Methanocaldococcus jannaschii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap