Conserved Protein Domain Family
cdhA

?
TIGR00314: cdhA 
CO dehydrogenase/acetyl-CoA synthase complex, epsilon subunit
Acetyl-CoA decarbonylase/synthase (ACDS) is a multienzyme complex. Carbon monoxide dehydrogenase is a synonym. The ACDS complex carries out an unusual reaction involving the reversible cleavage and synthesis of acetyl-CoA in methanogens. The model contains the prosite signature for 4Fe-4S ferredoxins [C-x(2)-C-x(2)-C-x(3)-C-[PEG]] between residues 448-462 of the model. [Energy metabolism, Chemoautotrophy]
Statistics
?
PSSM-Id: 129414
View PSSM: TIGR00314
Aligned: 4 rows
Threshold Bit Score: 1379.93
Threshold Setting Gi: 3915661
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q57617         8 EMDi-kKLLTPLVKMKNANISMSIKFGEEEEEeWEPMGPTPMPKIPTLRHWDFKLLERYPPFYMPICDLCCLCTFGKCDL 86  Methanocaldococ...
O27743         7 ESKkakDLKGDFWDAKNIQISIGEIITEEKPPeEEVKGPKPRPHVTDLRSWDMKLLERYEPFYAPFCDMCCLCTYGKCEL 86  Methanothermoba...
WP_010878596   3 ELK---KGALFVDEMKNVSIRIGKVVEEEEEV-WEEAGPTPKPGILELRKWDHKLLERYEPFYAPMQDFCNLCTMGPCDL 78  Archaeoglobus f...
WP_010879884   4 EFG---KGAFVVDDLRNVTIKIGEIAEE-EEE-WAPMGPTPMPGIATLRDWDFFLLKRYKPFYAPACDMCCLCTMGKCDL 78  Archaeoglobus f...
Q57617        87 SrGKKGACGLNIKAQQARIVLIACCIGAACHAGHSRHLVHHLIETLG---RDYPIDLGNEIEVEAPIARTVTGIKPKTLG 163 Methanocaldococ...
O27743        87 L-GKKGACGIDAATQQARTVLLACLIGTAAHAGHARHLVDHLIERLG---EDYKIDLGSNVDIEAPITRTVMGKRPATLG 162 Methanothermoba...
WP_010878596  79 SmNKRGACGIDLKTAKARLVTIACCIGASAHTAHARHLVDHLIEEFG---EDFPIDLGGDVNVEAPIIRTVVGIKPKTLG 155 Archaeoglobus f...
WP_010879884  79 TgNKRGACGIDLAAQTGRIVTIACSIGVSAHTGHARHMLHDIEHMTGkklSEIPVDLGPEIDEVAPLTELITGIKPKTLE 158 Archaeoglobus f...
Q57617       164 DLEKILDYCEEQITHLLSAAHTGQEGDYLDFESKALHAGMIDDLAREAGDLAQIVAYNMPKGDEDAPLIELGFGCIDKSK 243 Methanocaldococ...
O27743       163 DLREVMDYAEEQMSHLLSACHTGQEGDSKDFESKAFHAGLMDDLTREVADLAQIVALDLPKGDEDAPLVELGFGTIDTEK 242 Methanothermoba...
WP_010878596 156 DLREALNWAEKEIVKVLHSTHIGNEESLLDYESKAMHVSMADHVGMEVADIAQIVAYNFPKAEPDTPLVDTGFGIVDKSK 235 Archaeoglobus f...
WP_010879884 159 DLERALRYAEEQIVQVVDAVHTGQEGSYLDYESKALHLGMLDSLGKEIADIAQICAFGYPKGEDNQPLIEVGMGVMDRSK 238 Archaeoglobus f...
Q57617       244 PVILCIGHNVVPGSYILEYLEENSMEDEVEVCGICCTAIDITRVSDKPKVVGPLSRQLMFVRSGVADVVIVDEQCIRTDI 323 Methanocaldococ...
O27743       243 PVVLCIGHNVLPGADIVDYLDENEMEDQVEVCGICCAAIDVTRYNEAAKVVGPLSKQLRFIRSGVADVIVVDEQCVRTDV 322 Methanothermoba...
WP_010878596 236 PTIVVVGHNVMYARPVADYLEEMGRIDDFELAGLCCTAHDMTRYNAKAKIFGPISYQLRVIRAGIPDVMISDEQCIRADL 315 Archaeoglobus f...
WP_010879884 239 AMILVIGHHAPPVLNIADYIEENGLEDEVDLGGICCTANDMTRYYQKAKIVSALGRQLKVIRAGLADVIVIDEQCIRADI 318 Archaeoglobus f...
Q57617       324 LEEVLKTGAVLIATNEKMCLGLEDVSHMDEDEIIGYLLRN--RAALLLDEKKVGKVAVEVAKIVAKERKDR---KTLPDL 398 Methanocaldococ...
O27743       323 LEEALKNRSAVIATTDKMCLGLPDMTDEDPDKIVNDLINGniEGALILDPEKVGEVAVKTAMKLAPIRKSL---KKLPDI 399 Methanothermoba...
WP_010878596 316 LEACKKMGIPLIATSDAAARGLPDVSDWPVEKIVDALVSGklPGVFLPIPEKVGQVAPLVAEAIFKKHGGErkyKFFESD 395 Archaeoglobus f...
WP_010879884 319 LYHTKKLGIPVICTNEKAMHALPDMTKEEPKNIIKYLLDGn-PGCVILDPLKVGEVAVEVARARRKQRGDDi--GPRLTE 395 Archaeoglobus f...
Q57617       399 NEVVELAKQCTECGWCNRNCPNAFKVKEAMALAKQ-GNFKGFIDl--YKRCYGCGRCEAICPRNLPIVSMTTKVGEAYYK 475 Methanocaldococ...
O27743       400 DEIIELASECTDCGWCQRVCPNSLPVMDAVKKAAD-GDLSKLEEmaiEELCYTCGRCEQECERNIPIVSMVTKAGERRVK 478 Methanothermoba...
WP_010878596 396 EALMEEINKCTQCMNCVFTCPHSLRVDQGMAHAQKtGDLSKLAQl--EEQCLACMKCEQACPKNIKIINVIMRANYDRLY 473 Archaeoglobus f...
WP_010879884 396 EQFMEYARACTQCGNCTIACPQGIRIGEAMEAAEN-GDRSKLEKe--WDVCIACGRCEQVCPKGIPIIDMYNYAAWNLIV 472 Archaeoglobus f...
Q57617       476 DLKFKMRAGRGPIKDVEIRSVGAPIVFGDIPGVVALVGCSNHPNGEEEVAMIAKEFLERKYIVVATGCAAMAIGMWKDKD 555 Methanocaldococ...
O27743       479 DEKYRIRAGRGPAQDVEIRRVGAPIVLGDIPGVVAFVGCSNYPEGGKDVALMAKEFLERNYIVVTTGCGAMSIGEYRDED 558 Methanothermoba...
WP_010878596 474 NKTGKTRVGRGPIQDTEIRKVGQPIVFGQIPGVIAAVGCINFPDEMKSIREILEEFLKRRYIVVTSGCHAMDIGMIKDEE 553 Archaeoglobus f...
WP_010879884 473 NEKGKLRRGRGPIRDSEIRNVGAPIVLGTIPGIIAVIGCGNYPNGTRDAYTIMDEFASRNYIVVTTGCMAFDAALYKDEE 552 Archaeoglobus f...
Q57617       556 GKTLYEKYPGEFRAGGLVNCGSCLSNCHITGAAIKIANIFAKVPLRGNYAEVADYILNKVGAVGVAWGAMSQKAAAIATG 635 Methanocaldococ...
O27743       559 GQTLYEKYGGQFDAKGLVNMGSCVSNAHVSGAAIKIANIFAQKPLEGNFEEIADYILNRVGACGVAWGAYSQKAAAIATG 638 Methanothermoba...
WP_010878596 554 GKTLYEKYPGNFDAGGLVNTGSCVANSHIAGAAIKIANIFAMRPLRGNYAEIADYVLNRVGAVGFSWGPYSHKAASIATG 633 Archaeoglobus f...
WP_010879884 553 GQTVYEKYHDRFDGGGVVQIGSCVANAHIHGAAIKVARIFAKRNIRANYEEIADYILNRVGACGVAWGAYSQKAASIATG 632 Archaeoglobus f...
Q57617       636 VNRWGIPVILGPHGAKYRRLYLSNG---EKFKVKDKKTGEILEIEPAPEHLIVTAENVKECICMIPKLCMRPNDTPKGRA 712 Methanocaldococ...
O27743       639 VNRWGIPVVLGPHGSKYRRLFLGRAddeEKWKLKDLRTGEVIDGEPAPEHLLYAAENREEATVMIAKLCIRPTDTPKGRQ 718 Methanothermoba...
WP_010878596 634 FNRLGVPVVVGPHGTKYRRAYIGKPwkkDKWWVYDIKSRQKVFIEPAPDSLLVAVETKEEAIVQLARLCIRPNDTNQGRQ 713 Archaeoglobus f...
WP_010879884 633 FNRLGIPAVVGPHGSKYRRAFLGRPyndEDWMVYDARTGEKVRIEPAPQDLLVAAETIEEAIPLMAKLCFRPNDTTQGRS 712 Archaeoglobus f...
Q57617       713 NKIYHYVDVYEKYFGRMPPDLEKFVRTEKDIPFMMKDKIMAYLEEK-GWKPLEk-------------YPQDPTILY 774 Methanocaldococcus ...
O27743       719 MKLSNYIDLHRKYLGTIPDDIDRFIRTEKDIPIVYKRDVMKILEEK-NWKPRE--------------LPKEPSLLE 779 Methanothermobacter...
WP_010878596 714 IKLTHYIELHQKYYGDLPDDWAVYVRSEADLPLKMRDQLLKVLEEQyGWKIDWdkkkivegpvrhfdAGFNPTIVE 789 Archaeoglobus fulgidus
WP_010879884 713 IKLTHYIDLSLKYLKRMPDDWHLFVRTEADLPLAKKEELLKELEDKhGWKIDWqkkkivegpirgyhAGFNPTNLE 788 Archaeoglobus fulgidus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap