Conserved Protein Domain Family
cobQ

?
TIGR00313: cobQ 
cobyric acid synthase CobQ
[Biosynthesis of cofactors, prosthetic groups, and carriers, Heme, porphyrin, and cobalamin]
Statistics
?
PSSM-Id: 129413
View PSSM: TIGR00313
Aligned: 4 rows
Threshold Bit Score: 767.418
Threshold Setting Gi: 6685342
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O28931         4 LMVGGTTSSAGKSLLAAAFCRILARRGYDVAPFKAQNMSLNSFVTSKGKEIAIAQAYQAFAAGIEPDERMNPVLLKPKGN 83  Archaeoglobus f...
WP_010873845  33 IMVVGTTSHAGKSFLTTGLCRLLRRRGDRVTPFKGQNMALNAFVTIDGGEMGHAQAVQAWAAGTVPRVAMNPILLKPQGD 112 Synechocystis s...
WP_010876424  16 IMVQGTSSSAGKSVMVAALCRIFSRRGYRVAPFKSQNMSLNSFTTAENREIAVAQVLQAEAAGIEPSHHMNPVLLKPKED 95  Methanothermoba...
WP_010869985   8 IMVVGTSSNSGKTTITAGLCRILANKGYKVAPFKSQNMSLNSRVAKEDGEIAIAQYTQSLACRVEPSVHFNPILLKPKGN 87  Methanocaldococ...
O28931        84 FVSQLVVMGEAVGDVDSRKYYGVKVEWLKRVVEEAYLSLAEEYDFVVIEGAGGMAEINLYERDLPNIHIARFARPDILIV 163 Archaeoglobus f...
WP_010873845 113 MTSQVIMLGQAVGTTRAQEYYQNYFDRGWQAIANSLETLAQDFDVVVCEGAGSPAEINLKHRDLTNMRVATHLQAATILI 192 Synechocystis s...
WP_010876424  96 FTSQVIVHGRPAGNMNFQDYQTEFRDTALEAIRESLEYLKSRYELIVIEGAGSPAEINMRDRDLANMEIAHLADADVILV 175 Methanothermoba...
WP_010869985  88 FISQVIVHGRPYKDMNYNEYRKNK-DFFLKKIKESLEILDREYDYVIMEGAGSCCEINLLKDDIANLRIAELVNAKAILV 166 Methanocaldococ...
O28931       164 GDIDRGGVFASLYGTYALLPDDVKPLVKGFVINRLRGREDVLESGIRELERLTGIRVLGVLPYLDYN-FPSEDSLNIEEW 242 Archaeoglobus f...
WP_010873845 193 ADIDRGGVFAHVVGTLQLLEPEERKLIKGIVINKFRGQRSLLDSGITWLEEYTGIPVLGVIPYGQNL-FSAEDSLDILER 271 Synechocystis s...
WP_010876424 176 ADIDRGGVFASIAGTLMLLDERDRSRIKGVVINKFRGNIDILMPGIERIEEITGVPVLGVLPYDEGLkLPEEDSASLSQR 255 Methanothermoba...
WP_010869985 167 ADIDRGGVFASIYGTIKLLPENWRKLIKGIIINKFRGNVEVLKEGIEKIEELTGIPVLGIVPYDENLvLPEEDSQVLQSM 246 Methanocaldococ...
O28931       243 GAEGT------VGIVRLPRVSNFTDFEPLREHA--R--FLSLNSSLNGCEVVIIPGSKDTIADLKALKSSKLGEEIVRKA 312 Archaeoglobus f...
WP_010873845 272 SGRPSked-irIVVLRLPRIANFTDFEPLEAESgvYvdYLPLEKQLGNPDAVIIPGSKTTIADLQALQNSGMAQQIMDYA 350 Synechocystis s...
WP_010876424 256 KYRGRgd--irVGVMRLPRISNFTDIDPLEYEEdvAvrLIETGDSLDDLDAIIIPGTRNTISDLIHLEENGFADEIRDLS 333 Methanothermoba...
WP_010869985 247 RSFGNaksgveINVVRFSKISNFTDLDPLRYDA--FikFIDFDDDITG-DILIFPGTRSSTKEAYYLKQHNFDEKVLEFL 323 Methanocaldococ...
O28931       313 GEIP-VIGICGGYQIMCRELVDMG-VEHGRIRAKGLGLLDAVTEF-REyRKRTVQVEKRVNGNAvildriRGEKVWGYEI 389 Archaeoglobus f...
WP_010873845 351 QAGGtVMGICGGYQMLGQTIADPEnIEGNVSNCQGLGLLPLTTVI-NQ-EKITRQCQTITHAPP------SGLTVTGYEI 422 Synechocystis s...
WP_010876424 334 REIP-VFGICGGFQMLGKRILDDArQESSEGSVDGLGLLDCETHFtGE-GKIISQSQGRVLGNGifs-gmRGETVEGYEL 410 Methanothermoba...
WP_010869985 324 KDGGiVIGICGGYQVLGKELIDKEkKESDVGDIEGLKIFDAKTYF-GN-DKVVKNSCGFLEIDN------KTFNVKGYEI 395 Methanocaldococ...
O28931       390 HKGITRA------SNPIFEDD---GCASE----------DGMCWGTYLHGLFWN-------ENVLR------ALGGYLGI 437 Archaeoglobus f...
WP_010873845 423 HQGLSRRsehsqdFLPMFDQEe-lGMVNA----------QQNLWGCYLHGLFDNgawrrcwLNNLRqrrgldPLPTSIGN 491 Synechocystis s...
WP_010876424 411 HEGTTVLg----dVKPLLRVDrgfGNTRSggfd---gavDGNVAGTYFHGIFHNfrfrryfTNLLRerkgiePLEYLDDN 483 Methanothermoba...
WP_010869985 396 HEGFTYSk-----EKPLIKIErgfGNCGNgfdgsikkfgDGLAIGTYFHGIFENyefrnyiINLIRkr--kgLDEIYGDS 468 Methanocaldococ...
O28931       438 KFRQKEDWADLIADEVEGRLDLGVL 462 Archaeoglobus fulgidus DSM 4304
WP_010873845 492 YQEQREGMLDSLADFVETHVNLEPI 516 Synechocystis sp. PCC 6803
WP_010876424 484 FSASRRFSIDRLAEIVEENMDLSII 508 Methanothermobacter thermautotrophicus
WP_010869985 469 YKDSIEKSLNYFAEVVERSVNLKPL 493 Methanocaldococcus jannaschii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap