Conserved Protein Domain Family
aIF-2beta

?
TIGR00311: aIF-2beta 
translation initiation factor aIF-2, beta subunit, putative
The trusted cutoff is set high enough to select only archaeal members. The suggested cutoff is set to include most eukaryotic members but largely exclude the related eIF-5. [Protein synthesis, Translation factors]
Statistics
?
PSSM-Id: 129411
View PSSM: TIGR00311
Aligned: 3 rows
Threshold Bit Score: 222.417
Threshold Setting Gi: 3122238
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O27958   4 SYEELLERAFEKLADKDVVrRERFEIPRVSIQREGARTILKNFSQIAKTLNRSEDHLYKYIVKSLGTAGFIDNGRLVLQG 83  Archaeoglobus fulgidu...
Q57562  11 DYKALLKRARSQIPDYVFQ-KDRFELPEIEILIEGNRTIIRNFRELAKAVNRDEEFFAKYLLKETGSAGNLEGGRLILQR 89  Methanocaldococcus ja...
O27797   3 DYEKLLERAIDQLPPEVFE-TKRFEVPKAYSVIQGNRTFIQNFREVADALNRDPQHLLKFLLRELGTAGNLEGGRAILQG 81  Methanothermobacter t...
O27958  84 KFTESELQKEVDDYVRLYVLCRECNSPDTEFIKEERVLMLRCLACGAKHPVRNI 137 Archaeoglobus fulgidus DSM 4304
Q57562  90 RISPELLKSRINDFLREYVICRECGKPDTKIIKEGRVHLLKCMACGAIRPIRMI 143 Methanocaldococcus jannaschii DSM 2661
O27797  82 KFTHFLINERIEDYVNKFVICHECNRPDTRIIREGRISLLKCEACGAKAPLKNV 135 Methanothermobacter thermautotrophicus str. Del...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap