Conserved Protein Domain Family
V_ATPase_subD

?
TIGR00309: V_ATPase_subD 
H(+)-transporting ATP synthase, vacuolar type, subunit D
Although this ATPase can run backwards, using a proton gradient to synthesize ATP, the primary biological role is to acidify some compartment, such as yeast vacuole (a lysosomal homolog) or the interior of a prokaryote. [Transport and binding proteins, Cations and iron carrying compounds]
Statistics
?
PSSM-Id: 129409
View PSSM: TIGR00309
Aligned: 5 rows
Threshold Bit Score: 231.637
Threshold Setting Gi: 384872649
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q58032   1 MQRVNPTRMELLKLKNKIKLAEKGHKLLKQKRDALIMEFFQIIEQASDLRDKVEAKLAEAYKDLIMAQTVMGTLAVKEAA 80  Methanocaldococcus ja...
O27034   6 IEGINPTRMELLKLKQREKLAVKGYSLLKEKRNALIMEFFNILERVKGSREKVEEHLKEAFSDLTEAQVLMGDTAVERAA 85  Methanothermobacter t...
O29099   1 MAEVQPTRMELIKLRRRIKMATRGHALLKMKRDGLIMEFRQLLEEAKEVIGGMVQKYEKAQSKLALAIAVDGIVAVRSIA 80  Archaeoglobus fulgidu...
P32610   5 REQVFPTRMTLGLMKTKLKGANQGYSLLKRKSEALTKRFRDITKRIDDAKQKMGRVMQTAAFSLAEVSYATGENIGYQVQ 84  Saccharomyces cerevis...
O51119   1 MSKIKLTKNDLKKQKDELKMFKRYLPTLQLKKQQLYMEIVKIENSYK-IKNLEQQKLKENISNWISLFSEKFPFESWIQV 79  Borrelia burgdorferi B31
Q58032  81 LAAKnDKLEVDMDTKNIMGVTVPTFEIYNVRRKVGE-RGYSPYGVSSKLDEAAKKFEEALELITELAEIETSIKLLAEEI 159 Methanocaldococcus ja...
O27034  86 MSVR-ESVEVDIDSRSIMGVVVPVVDARATQRTVVE-RGYGLVDTSVKLDEAARKFEESLALIIELGEIEKTIRLLAGEI 163 Methanothermobacter t...
O29099  81 LSCCqIPPEFSMKRKNIMGVVVPVIKREPIRKKPTE-RGYGILSTSTRVDEAVEAYEELVDAVLEVAEIETTLRKLIEEI 159 Archaeoglobus fulgidu...
P32610  85 ESVStARFKVRARQENVSGVYLSQFESY-IDPEINDfRLTGLGRGGQQVQRAKEIYSRAVETLVELASLQTAFIILDEVI 163 Saccharomyces cerevis...
O51119  80 KTVV-------KKSLNIAGVAIPIFDSIEYEDIRHD-----LLFTPYWVDKGIEILKVVIQIDVELKILKKQIDLLLREF 147 Borrelia burgdorferi B31
Q58032 160 ITTKRRVNALEYVIIPRLKSLKKYISMRLDEMERENFFRLKLIKSRIEKR 209 Methanocaldococcus jannaschii DSM 2661
O27034 164 ESTKRRVNALEHIIIPRLKNTVKYIEMRLEEMERENFVRLKMIKKSMEME 213 Methanothermobacter thermautotrophicus str. Delta H
O29099 160 ERTKRRVNALEYRVIPTMEELAKFISFKLEEMDRENIIRLKKLKMKKAKS 209 Archaeoglobus fulgidus DSM 4304
P32610 164 KVTNRRVNAIEHVIIPRTENTIAYINSELDELDREEFYRLKKVQEKKQNE 213 Saccharomyces cerevisiae S288c
O51119 148 RITSQRVNLFEKVMIPTAKANIKKINIYLGDQQTAAVVRGKIAKSSLIKK 197 Borrelia burgdorferi B31
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap