Conserved Protein Domain Family
eS8

?
TIGR00307: eS8 
ribosomal protein eS8
Archaeal and eukaryotic ribosomal protein S8. This model could easily have been split into two models, one for eukaryotic S8 and one for archaeal S8; eukaryotic forms invariably have in insert of about 80 residues that archaeal forms of S8 do not. [Protein synthesis, Ribosomal proteins: synthesis and modification]
Statistics
?
PSSM-Id: 129407
View PSSM: TIGR00307
Aligned: 4 rows
Threshold Bit Score: 165.018
Threshold Setting Gi: 407523
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAA81525   1 MGISRdSRHKRSATGAKRAQFRKKRKFELGRQPANTKIGAK--RIHSVRTRGGNKKYRALRIETGNFSWASEGISKKTRI 78  baker's yeast
P54055     1 MSVWQ-GRSRRKPTGGLYRPARKKRKYEMGREPIETHVAEEafKIKKVRTRGGNLKVKVVRTGFANVLDPETGTCKKVKI 79  Methanocaldococcus ...
O28130     1 -MIWQ-GRSRRKPSGGFYRKARKKRKYELGREQVETLIGER--KVKKIRVRGGNYKLKLFADKYANVYDPKQGKVVRVEI 76  Archaeoglobus fulgi...
O26309     1 MAIWQ-GKSMKKPSGGRAKMNRGKRKYELGREPAETKIGDR--RVRLIRTRGGNTKVRLASDTRINVVDPETGKVEIAEI 77  Methanothermobacter...
CAA81525  79 AGVVYHPSNNELVRTNTLTKAAIVQIDATpfrqwfeahygqtlgkkknvkeeetvaksknaerkwaaraasakiessves 158 baker's yeast
P54055    80 ITVRENKANIHYVRRNVITKGAIIETEIG--------------------------------------------------- 108 Methanocaldococcus ...
O28130    77 ESVVENPAHVHYARRNVITKGAIIATSIG--------------------------------------------------- 105 Archaeoglobus fulgi...
O26309    78 RNVVENTANPHFVRRNIITRGAVVETNLG--------------------------------------------------- 106 Methanothermobacter...
CAA81525 159 qfsagrlYACISSRPGQSGRCDGYILEG 186 baker's yeast
P54055   109 -------LAKVTSRPGQDGTVNAILIKE 129 Methanocaldococcus jannaschii DSM 2661
O28130   106 -------KARVTNRPSQEGVVNAVLIE- 125 Archaeoglobus fulgidus DSM 4304
O26309   107 -------NVRVTSRPGQDGVINGVLIRE 127 Methanothermobacter thermautotrophicus str. Delta H
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap