Conserved Protein Domain Family
TIGR00300

?
TIGR00300: TIGR00300 
TIGR00300 family protein
All members of the family come from genome projects. A partial length search brings in two plant lysine-ketoglutarate reductase/saccharopine dehydrogenase bifunctional enzymes hitting the N-terminal region of the family. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 129401
View PSSM: TIGR00300
Aligned: 4 rows
Threshold Bit Score: 695.027
Threshold Setting Gi: 499181233
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_010874123 283 IESRVIRMEGHLLDAGILNQALDLVVENSGSFRVLNFNLGVERNSTSSAEVRVSAPSHQIMEEIMTELIDLGAVPPpqEL 362 Synechocystis s...
WP_010876500   1 MNTREVELRGHIIDSLILPRALDIIMDMGGDFQILEIDIGKRKSDPSHARILVEAETPSLLNQILDELGEIGASIA--EI 78  Methanothermoba...
WP_010871002   1 MFMREIELRGHIIDSLILPKVFDKILDMGGDYKVLEFEIGKRKTDPSYAKILVIGRDERHVDEILNELRDLGAEIP--EI 78  Methanocaldococ...
WP_010878773   1 MKAREVEFEGHLIDSMIFTKALDIILDLDGEFEILEFRVGKKKDDPSYARMIVFGRDDAHLEQILKELHKIGARIP--DI 78  Archaeoglobus f...
WP_010874123 363 CDINTETVTQGGVAPDDFYVSTIYPTEVRVNCEWVQVTGQRMDAAIVVTSNPPSARCVLLRDLQVGDRVMVGVEGIRTIK 442 Synechocystis s...
WP_010876500  79 KEAELRRAPMDRVLPDDFYSTTNHQTFIYHGGEWVEVEGIEMDCMIVVDPESRTARCKPIREIKKGDLVVVGREGIKVVP 158 Methanothermoba...
WP_010871002  79 EEVELQPAEKDMVLPEGFYSTTNHKTFIRFKGKWIEVENQKMDGAIVVYPDEMRAEVKTIRNIKKGDLVVVGHKGVRVIP 158 Methanocaldococ...
WP_010878773  79 EEVELAEAPADKVLPDGFYVTTNHPTFVRYGGEWLPVEDISMDRVIVIR--DGRAYCIPIDEVVRGDRVVVGEKGVRVVP 156 Archaeoglobus f...
WP_010874123 443 KVESHeGGTrkenKEFAFMAAGVSSERRVELLVEQIAWEMRQIRDQGGKIVVTAG-----PVVIHTGGAQHLSHLVREGY 517 Synechocystis s...
WP_010876500 159 PERPR-GKQ----GVFEFMGSEVSSEKPLVTTIKKIASEITEIKKRGGRIGLVGG-----PAIVHTGSAPVIAEMIRLGF 228 Methanothermoba...
WP_010871002 159 PEKPReGG-----GLFEFMKSDASSEKPKETIIRRIAKEMYEIREKYRKTGKGGIvvvggPAIIHTGAGWALAKLIRMGY 233 Methanocaldococ...
WP_010878773 157 PERPR--KS----TVFEFMGGRVSSERPTERMIEAIAREIYELKLKGGKIAVVAG-----PAVDHTSARNALAALIRDGY 225 Archaeoglobus f...
WP_010874123 518 VHALLGGNAIAVHDIEQATMGTSLGVDMQRGIPVRGGHRHHLKIINSVRRYGGIRQAVEAGFISKGVMYECVKNNIPYCL 597 Synechocystis s...
WP_010876500 229 IDVLFAGNALATHDIECALYGTSLGVDIDRGEAVSRGHRHHINAINEINRAGSIRDAVEQGVLTSGIMYECVKNDVPFVL 308 Methanothermoba...
WP_010871002 234 VQALFAGNALATHDIESVLYGTSLGVDLKTGKSVPGGHSHHLRAINTIMRAGSIKDAVEQGILKEGVMYECIKNNIPYVL 313 Methanocaldococ...
WP_010878773 226 VDLLLSGNALAVHDIEISIFGTSLGMDICKGRPVPGGNRHHLYTISKVIAAGGIKKAIEKGIIKDGIMYECVKNNVPFIL 305 Archaeoglobus f...
WP_010874123 598 AGSIRDDGPLPDTEMNLVRAQSRYSELIQGADMILMLSSMLHSIGVGNMTPSGVKMVCVDINPAVVTKLSDRGSVESVGV 677 Synechocystis s...
WP_010876500 309 AGSIRDDGPLPDVITDVMEAQNEMRKYVQDLDMVIMIATMLHSIATGNILPSRVKTICVDINPATVTKLSDRGSSQAVSV 388 Methanothermoba...
WP_010871002 314 AGSIRDDGPLPDVITDVVKAQEKMRELLKGKDMVLMLSTMLHSIATGNLLPSWVKTICVDINPAVVTKLMDRGTSQALGI 393 Methanocaldococ...
WP_010878773 306 AGSIRDDGPLPEVITDVMVAKKKMKEALRGINMVIMLATMLHSIAVGNLLPSYVKTICVDMNPSTVTKLMDRGTHQAIGV 385 Archaeoglobus f...
WP_010874123 678 VTDVGLFLSLLVRQLQQL 695 Synechocystis sp. PCC 6803
WP_010876500 389 VTDVGAFIPILLHEIKKM 406 Methanothermobacter thermautotrophicus
WP_010871002 394 VTDVGVFLPMLVeelekl 411 Methanocaldococcus jannaschii
WP_010878773 386 VTDVGLFLPLLYLKIKEI 403 Archaeoglobus fulgidus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap