Conserved Protein Domain Family
TIGR00299

?
TIGR00299: TIGR00299 
TIGR00299 family protein
Members of this family are found in the Archaea and in several different bacteria lineages. The function in unknown and the genomic context is not well conserved. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 129400
View PSSM: TIGR00299
Aligned: 4 rows
Threshold Bit Score: 564.045
Threshold Setting Gi: 499182048
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_010871363   4 IAYFDC-PTGISGDMCLGALVSAGVPLEYLMEKLAPLGLT-DEYRLTAGLVQKQGQAATKVEVKLLndhhshGPGHHGMR 81  Synechocystis s...
WP_010876733   9 VTVIDPqLAGVSGNMMVGALIDLGAHPERTAEVMEDAASHfGGADVSVSEVKRAGLRATYVDVRAD------ESLSVGYL 82  Methanothermoba...
WP_010870904   1 MFLLDP-FSGISGDMFLSAMIDF-VDKEDFINTIKKVID----VEIEIKKVKKCHILANKVNI-IP------KCINCNAN 67  Methanocaldococ...
WP_010879588   3 VAIFDA-FNGASGDMILASLLGVGISEEEIDEVVKALGID---VNYSMTTVSVRGISARRVEV----------EERDGER 68  Archaeoglobus f...
WP_010871363  82 HLPEIEQLIKQANLPARVSRWSLAIFHQLAIAEGEVHGIEPEAVHFHEVGATDAIVDIVGTCLGLDYLG-IDQCYW-S-A 158 Synechocystis s...
WP_010876733  83 EFLRLLEGISHPALDDEMLSMARAVFHTIAQAEASVHGVKLDEVHFHEVGAADAVADVMGAVFAYFDLNlHRDEVY-TlP 161 Methanothermoba...
WP_010870904  68 TYKDIKNVIKSSDIQEDIKITALEILKILAEAESKVHNVDVENVHFHEVGNYDTIADIVGAAYIINKLNlKNNCLY-K-P 145 Methanocaldococ...
WP_010879588  69 SFKEVLEIIRSSNLEEGVKKNAIAVFELIARAEGKVHGRDYREGVFHEVGADDAIFDVVCCVKAFENLKtAGYEFFaT-P 147 Archaeoglobus f...
WP_010871363 159 LPTGSGTVRAAHGDLPVPVPAVLKLWQTrqVPVYDNGLTGELVTPTGAAIAVTLASQFGPKppLNLHKVG---LGAGSKD 235 Synechocystis s...
WP_010876733 162 VAVGGGLVRGAHGLTPVPAPATTEILRG--FPVTGGPSGVELATPTGSALLVNMVREHRRF--FPPMEIQatgYGAGSMD 237 Methanothermoba...
WP_010870904 146 INVGNGFVRTEHGLLPVPAPATAEILKG--LKIFFSDINEELTTPTGSAIIKYINPKLAKGa-FIIKEVS---YGAGDKD 219 Methanocaldococ...
WP_010879588 148 VRAGSGFVEFSHGKYPVPPPAVLEILKSsnLEVVMDGEG-ELLTPTGAAILSHYCKPLKPFp-IRVKEVS---YGAGKRE 222 Archaeoglobus f...
WP_010871363 236 FPLANILRLWIGTEITPHnhplsseapfgqlETITVLETQLDDIQPQAVGYLLESLLHQ-GAIDVFTQAIAMKKSRPGIL 314 Synechocystis s...
WP_010876733 238 PEFPNILRIVRGSGQVPH-------------DTVTLLETNVDHLSGEVLGNIFERLLEA-GALDVTLTPVIMKKNRPGQL 303 Methanothermoba...
WP_010870904 220 LNLLNALRVFR-VEDIKR-------------EDIVLLETNVDDISAEILGYLYE-VLDG-KVRDLHFIPTYMKKNRPAYT 283 Methanocaldococ...
WP_010879588 223 TDVPNVLRLILG-ETAFH-------------DSIVVIETSVDDLSGEMIGYAMKKLLERdDVLDAVIIPAYGKKMRPASI 288 Archaeoglobus f...
WP_010871363 315 LTVLCAPENQNHCLNLLFRETTSLGVRVR-QQQRYALEREWQTVVIPHGPIRiKVAYGYQAGKKIILNAHPEFADCAALA 393 Synechocystis s...
WP_010876733 304 IRVICRENEYERILEHLFSETGTLGVRIFpQVHRGVLERRIMEAEVDIKGRR-TARFKVGLMGSRVVNARIEYEDARRIS 382 Methanothermoba...
WP_010870904 284 IRAIVDRDIAEEVAKIIMRETGSLGVRIF-DIERITADREFKTIKL---FDE-SVRLKVGRVNDEIISQKPEFEDLKNIA 358 Methanocaldococ...
WP_010879588 289 LKVISPTHRSEEVAAEVMRLTGSLGIRIIpVHHRLISERMEEVVKVEISGKEfDVRVKRSYPGFRHL--KPEFDDIAVIA 366 Archaeoglobus f...
WP_010871363 394 KATGQPWQLIH 404 Synechocystis sp. PCC 6803
WP_010876733 383 LETGIPLRDVI 393 Methanothermobacter thermautotrophicus
WP_010870904 359 KKYGIPLKDLY 369 Methanocaldococcus jannaschii
WP_010879588 367 DELNIPPHVVY 377 Archaeoglobus fulgidus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap