Conserved Protein Domain Family
TIGR00294

?
TIGR00294: TIGR00294 
GTP cyclohydrolase, MptA/FolE2 family
This family includes type I GTP cyclohydrolases involved in methanopterin in archaea (MptA) and de novo tetrahydrofolate biosynthesis in bacteria (FolE2). [Biosynthesis of cofactors, prosthetic groups, and carriers, Other]
Statistics
?
PSSM-Id: 129395
View PSSM: TIGR00294
Aligned: 4 rows
Threshold Bit Score: 419.265
Threshold Setting Gi: 1805406
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q58185         6 DVQNFEPDVKISLTRVG-VTNLKKLVRLKRTNKRPIILLSTFEVFVNLPSSQKGIHMSRNPEVIEGIIDEALELESYEME 84  Methanocaldococ...
WP_010876820   8 DTQDKIPSIPVHLTRVG-VTGVKKLLKIEREGRRPIILLPTFDAFVDLPSKQRGIHMSRNPEAISDVLEEVVENNALELE 86  Methanothermoba...
WP_010878675   4 DVQLLKPEVPIGLSRVG-ATGIKKLVEVQREGKRPIILISTFDVFVDLPAHLKGVNLSRNFEVIDEVLETLTAKPIENIE 82  Archaeoglobus f...
BAA08968       2 NQHTLLPKKTERLQYFGsVSPIKGEKPVEKEKMKDLQNIR-KDYFFDIQ--HVGVANVSHPVTITSAMMPAEQTTAANFT 78  Bacillus subtilis
Q58185        85 TICEEIVKR-LFEKHEYATEAEVFMVSDFMTKEKSPISGKYSQEIHKIMGGAKGIKKDDE--IELTKIVGAEVVGITACP 161 Methanocaldococ...
WP_010876820  87 SLCAEIVNE-LLKKHRYARRAEVSMNSDFMFMKRSPVTRRKSQEMTKIMADAIGYRDDDG--IVIRKMIGAEVVGMTVCP 163 Methanothermoba...
WP_010878675  83 DLVVEIADH-LLKRHEYATKAEARMNSELIMRKRTPKTGQRTQEVVKIFGEATLGRDGS-----KVIMVGVEVTGITACP 156 Archaeoglobus f...
BAA08968      79 MTCNLPRNQkGINMSRLTELLQVYHQNGWILSFSS--LQQFTKELAENMDTSSATVEVRFpwFFERKSPKLEKAGLMHAD 156 Bacillus subtilis
Q58185       162 CAQNLIKEICIKNLKEKgFSDED---IDKILDSVIFATHNQRG----IGRIILEVPTGYDIEIMDIIEIIKKSMSAEIHG 234 Methanocaldococ...
WP_010876820 164 CAQESVREASRQKLLEF-LDDET---VERVLDCVSFASHNQSG----RGMIMIEVPEDQTIRAEKLIDIIESSMSSPVYE 235 Methanothermoba...
WP_010878675 157 CAQELVKASSAERLAKMgFDEET---IQKILDAIPVATHNQRG----RATLKVQVTDSFKVPIAKLIDVAKSSMSYETYE 229 Archaeoglobus f...
BAA08968     157 IFMSVTYRKDQPFKQRAgISAKVttlCPCSKEISEYSAHNQRGtvkhLGRIFTRAASLPSDVKADLPHAAESNASARLHP 236 Bacillus subtilis
Q58185       235 ILKRADEAYVVEQSHKNPKFVEDCVREMAKRVVEKFKHLPDETKVLIRQINMESIHRHDAFAEKVATLGELRRELLSYE 313 Methanocaldococc...
WP_010876820 236 LLKRPDENAVVMSAHENPMFVEDCVRNMVHRIVSEYPHLPDDTIVTVRQINEESIHRHNAFAEKVATMGELRYEIEELN 314 Methanothermobac...
WP_010878675 230 ILKREDELAVVEAAHRNTRFVEDGVRYMAMELLKTFPNAPDDILVFLRQENEESIHQHNVVAERFATFGELRNEIGSPD 308 Archaeoglobus fu...
BAA08968     237 VLKRPDEKAVTETAYENPRFVEDLARLIAADLFELEWVS--AFEIECR--NEESIHLHRCLCE--VCFSKEVDKI---- 305 Bacillus subtilis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap