1FXK,2ZDI


Conserved Protein Domain Family
TIGR00293

?
TIGR00293: TIGR00293 
Click on image for an interactive view with Cn3D
prefoldin, archaeal alpha subunit/eukaryotic subunit 5
Members of this protein family, rich in coiled coil regions, are molecular chaperones in the class of the prefoldin (GimC) alpha subunit. Prefoldin is a hexamer of two alpha and four beta subunits. This protein appears universal in the archaea but is restricted to Aquifex aeolicus among bacteria so far. Eukaryotes have several related proteins; only prefoldin subunit 5, which appeared the most similar to archaeal prefoldin alpha, is included in this model. This model finds a set of small proteins from the Archaea and from Aquifex aeolicus that may represent two orthologous groups. The proteins are predicted to be mostly coiled coil, and the model may have a significant number of hits to proteins that contain coiled coil regions. [Protein fate, Protein folding and stabilization]
Statistics
?
PSSM-Id: 129394
View PSSM: TIGR00293
Aligned: 17 rows
Threshold Bit Score: 82.3272
Threshold Setting Gi: 12230448
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1FXK_C   3 LAEIVAQLNIYQSQVELIQQQMEAVRATISELEILEKTLSDIQGK----DGSETLVPVGAGSFIKAELKDT--SEVIMSV 76  Methanothermobacter t...
Q99471  12 LPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSn---EGKELLVPLTSSMYVPGKLHDV--EHVLIDV 86  human
Q04493  13 PEQLNAVKQQFDQELQHFTQSLQALTMAKGKFTECIDDIKTVSQAg--nEGQKLLVPASASLYIPGKIVDN--KKFMVDI 88  Saccharomyces cerevis...
P57742  15 IDQLKALKEQADLEVNLLQDSLNNIRTATVRLDAAAAALNDLSLRp---QGKKMLVPLTASLYVPGTLDEA--DKVLVDI 89  thale cress
Q21993  15 LQQLGELQKNCEQELNFFQESFNALKGLLTRNEKSISALDDVKIAt---AGHTALIPLSESLYIRAELSDP--SKHLVEI 89  Caenorhabditis elegans
Q58064   5 VIDINEAVRAYIAQIEGLRAEIGRLDATIATLRQSLATLKSLKTLg---EGKTVLVPVGSIAQVEMKVEKM--DKVVVSV 79  Methanocaldococcus ja...
O28216   7 VQEKIATLQILQEEAEALQRRLMELEILENEYRKTLETLEFFESId---TSVEALMNLGGGVFAYVDVKNS--KKMLVDI 81  Archaeoglobus fulgidu...
Q8ZTT9   6 VQRLLEEYQLIGELLSSLQAQHATVAELLEELTTALDGVRLLKGE-----GGERLVHIGAGLFVKG-VFEA--KEVLAPL 77  Pyrobaculum aerophilu...
P58179  10 LDELIAQADYLKRYIDSLQRTQLELLESINSIDSAKQAIETMKSG-----NKEMLVFIDRKGYLLAKVGGIigDKVTVHL 84  Sulfolobus solfataric...
Q8PYQ1   8 IRNLAARHQEFQRQAEALRQEMSMVQASIASCDQAIATINELKAAseagRAAETMVPVGFGSYVYAEVKNP--DKVVVNL 85  Methanosarcina mazei Go1
1FXK_C  77 GAGVAIKKNFEDAMESIKSQKNELESTLQKMGENLRAITDIMMKLSPQAEEL 128 Methanothermobacter thermautotrophicus
Q99471  87 GTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQK 138 human
Q04493  89 GTGYYVEKSAEAAIAFYQKKVDKLNKESVQIQDIIKEKTQYSLSIEAQIRQA 140 Saccharomyces cerevisiae S288c
P57742  90 GTGYFIEKTMDDGKDYCQRKINLLKSNFDQLFEVAAKKKSVADEAGMVLQAK 141 thale cress
Q21993  90 GTGYFVELDREKAKAIFDRKKEHITKQVETVEGILKEKRRTRAYISDAFQTK 141 Caenorhabditis elegans
Q58064  80 GQNISAELEYEEALKYIEDEIKKLLTFRLVLEQAIAELYAKIEDLIAEAQQT 131 Methanocaldococcus jannaschii DSM 2661
O28216  82 GSGVVVEREVGEAIEFVKNRIKKIEENQEKMTSMLQQVLSQAQRIQQELAAR 133 Archaeoglobus fulgidus DSM 4304
Q8ZTT9  78 GAGYHAFLDLNNAERILQERIEEYSKLKTSLEENIEKLAERAAQIRQALERL 129 Pyrobaculum aerophilum str. IM2
P58179  85 GLSYYAEVDLDSAIKILDKRKDEISKAAQDLNNELQKAASTYNQIVDILNQI 136 Sulfolobus solfataricus P2
Q8PYQ1  86 GAGFSAEETAEAAVETLNRRKEQLTKILEQMNASLTKIAQGMQALETEAAKI 137 Methanosarcina mazei Go1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap