1P9Q,2WBM


Conserved Protein Domain Family
RNA_SBDS

?
TIGR00291: RNA_SBDS 
Click on image for an interactive view with Cn3D
rRNA metabolism protein, SBDS family
This protein family, possibly universal in both archaea and eukaryotes, appears to be involved in (ribosomal) RNA metabolism. Mutations in the human ortholog are associated with Shwachman-Bodian-Diamond syndrome. [Protein synthesis, Other]
Statistics
?
PSSM-Id: 129392
View PSSM: TIGR00291
Aligned: 6 rows
Threshold Bit Score: 332.57
Threshold Setting Gi: 2501598
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1P9Q_C  23 MVSLDKAVIARLRKGGEEFEVLVDPYLARDLK-EGKEVNFEDLLAAEEVFKDAKKGERASVDELRKIFGTDDVFEIARKI 101 Archaeoglobus fulgidus
O29759   1 MVSLDKAVIARLRKGGEEFEVLVDPYLARDLK-EGKEVNFEDLLAAEEVFKDAKKGERASVDELRKIFGTDDVFEIARKI 79  Archaeoglobus fulgidu...
Q58011   6 MVSLEEAVIARYTSHGEKFEILVDPYLAAKLK-EGQNVDFDELLAIEVVFRDASKGEKAPEELLSKIFGTTDVKEIAKKI 84  Methanocaldococcus ja...
O26781   1 MVSLEDAVIARLESHGERFEVLVDPDLAAEFRrEDSDVSVEDVLAVQEVFRDARKGDKASEEAMRKVFETADPLEVTPVI 80  Methanothermobacter t...
Q07953   9 QIKLTNVSLVRLKKARKRFEVACYQNKVQDYR-KGIEKDLDEVLQIHQVFMNVSKGLVANKEDLQKCFGTTNVDDVIEEI 87  Saccharomyces cerevis...
2WBM_A  21 MVSLEDAVIARLESHGERFEVLVDPDLAAEFRrEDSDVSVEDVLAVQEVFRDARKGDKASEEAMRKVFETADPLEVTPVI 100 Methanothermobacter t...
1P9Q_C 102 ILEGEVQITAEQRREMLEAKRKQIINFISRNTIDPRTNAPHPPSRIERALEEAKVHIDIFKSVEAQVKDIVKALK--PIL 179 Archaeoglobus fulgidus
O29759  80 ILEGEVQITAEQRREMLEAKRKQIINFISRNTIDPRTNAPHPPSRIERALEEAKVHIDIFKSVEAQVKDIVKALK--PIL 157 Archaeoglobus fulgidu...
Q58011  85 ILKGQVQLTAKQREEIREQKKRQIITIISRNTINPQTDTPHPPHRIEKAMEELRINIDIYKSAEEQVPEIVKKLK--KVL 162 Methanocaldococcus ja...
O26781  81 LRRGTIQLTAEQRRQMIEDKRLKIINKIAREAINPQNGLPHPPKRIEKAMEEARVHVDPFKTVDEQVNIVLKAIR--TKI 158 Methanothermobacter t...
Q07953  88 MHKGEIQLSEKERQLMLNKVNNEMLTIVSAKCINPVSKKRYPPTMIHKALQELKFSPVINKPAKLQALEAIKLLVskQII 167 Saccharomyces cerevis...
2WBM_A 101 LRRGTIQLTAEQRRQMIEDKRLKIINKIAREAINPQNGLPHPPKRIEKAMEEARVHVDPFKTVDEQVNIVLKAIR--TKI 178 Methanothermobacter t...
1P9Q_C 180 PLKFEEMEIAIKIP-PEHTGRAISALYNFGGVTREE--WQRDGSWICVMRIPSGMYGDLMDLLGKVAKGEALTKVLR 253 Archaeoglobus fulgidus
O29759 158 PLKFEEMEIAIKIP-PEHTGRAISALYNFGGVTREE--WQRDGSWICVMRIPSGMYGDLMDLLGKVAKGEALTKVLR 231 Archaeoglobus fulgidus D...
Q58011 163 PIRFEKRDIAVKIP-AEFASKAYNALYQFGAVKQEE--WQPDGSLIVLIEIPSGIEAEFYAHLNKITKGNVQTKVVK 236 Methanocaldococcus janna...
O26781 159 PIKFEKVRVAIKIP-GERAGSAYGVISNFGKITNEE--WQNDGSWIAVVEIPGGLQDSFYQKLSELTGGNVETRLIK 232 Methanothermobacter ther...
Q07953 168 PIVRAKMKVKVAISePSRQPELIEKISKLIASSPGEstKPELDPWTCTGLIDPVNYRDLMTLCDKKGTVQVLDMAVI 244 Saccharomyces cerevisiae...
2WBM_A 179 PIKFEKVRVAIKIP-GEMAGSAYGVISNFGKITNEE--WQNDGSWIAVVEIPGGLQDSFYQKLSELTGGNVETRLIK 252 Methanothermobacter ther...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap