Conserved Protein Domain Family
TIGR00289

?
TIGR00289: TIGR00289 
TIGR00289 family protein
Homologous proteins related to MJ0570 of Methanococcus jannaschii include both the apparent orthologs found by this model above the trusted cutoff, the much longer protein YLR143W from Saccharomyces cerevisiae, and second homologous proteins from Archaeoglobus fulgidus and Pyrococcus horikoshii that appear to represent a second orthologous group. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 129390
View PSSM: TIGR00289
Aligned: 3 rows
Threshold Bit Score: 368.808
Threshold Setting Gi: 499181622
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q57990         1 MKVAVLYSGGKDSNYALYWALKEgFDVKYLVNVESENKESYMFHIPNVHLTELSAEAVGIPLIKLYTKGEKEKEVEDLKK 80  Methanocaldococ...
WP_010876071   1 MRSAVLYSGGKDSTMALYHALQE-SEVEFLVSVISDNPESHMYHVPNIHLTALLAEAVGIPLIESRTAGVEEEEVEDLAG 79  Methanothermoba...
WP_010879162   1 MKVAALISGGKDSILALHKVAEK-HEVISLVGIFPENEDSYMFHSVNLHMLDVVAESLGLPLKKLYVSGEEEKEVDELAG 79  Archaeoglobus f...
Q57990        81 GLEKLD---VEGIVTGAVASIYQKSRIDRVCEELGLKSFAPLWHKDP-EWILRTVSELFNVRIVGVYAYGLGKEWLGKRI 156 Methanocaldococ...
WP_010876071  80 TLKTLRergVEAVYSGALYSEYQKSRIDSICRRLGLRSVAPLWHRDPlDYMEEIVDLGFRVMVTAVAAEGLDESWLGRIV 159 Methanothermoba...
WP_010879162  80 QIGEVD---ADALCIGGIESNYQKKRFEKVCREVGMKLIAPLWKANP-EKLMYEVAEKFEAIIVSVSAMGLDESFLGRRI 155 Archaeoglobus f...
Q57990       157 TKENIDKLLNICEKYGIHKAFEGGEAETFVFDAPMFKKRIEVVEAEIEWHETWGIYHIKKAKLVDKE 223 Methanocaldococcus jannaschi...
WP_010876071 160 DRKMIDELADLSERYGINPAFEGGEAESLVLDGPIFKKRLEILEYEKKWFFDNGFLDIKRAVLVDKD 226 Methanothermobacter thermaut...
WP_010879162 156 DKECIEDLKRLNEKYSVHLAGEGGEFETLVLDAPLYRFRIKVDSIRKFWDGVRGYCLIERYSKISKT 222 Archaeoglobus fulgidus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap