1NFH,1NH9


Conserved Protein Domain Family
TIGR00285

?
TIGR00285: TIGR00285 
Click on image for an interactive view with Cn3D
DNA-binding protein Alba
Alba has been shown to bind DNA and affect DNA supercoiling in a temperature dependent manner. It is regulated by acetylation (alba = acetylation lowers binding affinity) by the Sir2 protein. Alba is proposed to play a role in establishment or maintenace of chromatin architecture and thereby in transcription repression. This protein appears so far only in the Archaea, but may be universal there. There is a single member in three of the first four completed archaeal genomes, and a second copy in A. fulgidus. In Sulfolobus shibatae there is a tandem second copy that is poorly conserved and scores below the trusted cutoff; all other members of the family are conserved at greater than 50 % pairwise identity. [DNA metabolism, Chromosome-associated proteins]
Statistics
?
PSSM-Id: 129386
View PSSM: TIGR00285
Aligned: 5 rows
Threshold Bit Score: 102.985
Threshold Setting Gi: 2495857
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1NFH_A        3 EHVVYVGNKPVMNYVLATLTQLNEgADEVVIKARGRAISRAVDVAEIVRNRFMPGVKVKEIKIDTEELESEQGRRSNVST 82  Archaeoglobus fu...
Q57665        2 DNVVLIGKKPVMNYVVAVLTQLTS-NDEVIIKARGKAINKAVDVAEMIRNRFIKDIKIKKIEIGTDKVKNPDGREVNVST 80  Methanocaldococc...
WP_010877093  5 ENVVYIGNKPVMNYVLAVVTQMNGgTSEVILKARGIAISRAVDVAEIVRNRFIPDIQIENIDICTEEIIGNEGTATNVSA 84  Methanothermobac...
WP_010878567  3 ENSVFVGNKPVMNYVLAVLTQFNSgATEVSIKARGRAISRAVDVAEIVRKRFLPDVDVKDIKISTEQIDSEQGT-ANVSA 81  Archaeoglobus fu...
1NH9_A        2 DNVVLIGKKPVMNYVVAVLTQLTS-NDEVIIKARGKAINKAVDVAEMIRNRFIKDIKIKKIEIGTDKVKNPDGREVNVST 80  Methanocaldococc...
1NFH_A       83 IEIVLAK 89  Archaeoglobus fulgidus
Q57665       81 IEIVLAK 87  Methanocaldococcus jannaschii DSM 2661
WP_010877093 85 IEIQLRK 91  Methanothermobacter thermautotrophicus
WP_010878567 82 IEIILAK 88  Archaeoglobus fulgidus
1NH9_A       81 IEIVLAK 87  Methanocaldococcus jannaschii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap