2ZV3,1RZW


Conserved Protein Domain Family
arch_pth2

?
TIGR00283: arch_pth2 
Click on image for an interactive view with Cn3D
peptidyl-tRNA hydrolase
This model describes an archaeal/eukaryotic form of peptidyl-tRNA hydrolase. Most bacterial forms are described by TIGR00447. [Protein synthesis, Other]
Statistics
?
PSSM-Id: 161803
View PSSM: TIGR00283
Aligned: 6 rows
Threshold Bit Score: 168.483
Threshold Setting Gi: 6686223
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2ZV3_A   1 MKMVVVIRNDLGMGKGKMVAQGGHAIIEAFLDAKR------KNPRAVDEWLREGQKKVVVKVNSEKELIDIYNKARSEGL 74  Methanocaldococcus ja...
Q60363   1 MKMVVVIRNDLGMGKGKMVAQGGHAIIEAFLDAKR------KNPRAVDEWLREGQKKVVVKVNSEKELIDIYNKARSEGL 74  Methanocaldococcus ja...
O27732   1 MKQVIIVRSDLKMGKGKIAAQACHASIGSFKRT---------EEDKIRKWELEGSKKVIVSVNSLDELLEIYRAVKEAGI 71  Methanothermobacter t...
O28185   3 LKQVIVVRDDLKLSRGKLAVQVAHAAIIGYLKS---------DSSLRRKWLDEGQKKVVLKVKSLEELLGIKHKAESLGL 73  Archaeoglobus fulgidu...
P34222  88 VRMALVIRQDLGMTKGKIAAQCCHAALSCFRHIATnparasYNPIMTQRWLNAGQAKITLKCPDKFTMDELYAKAISLGV 167 Saccharomyces cerevis...
1RZW_A   3 LKQVIVVRDDLKLSRGKLAVQVAHAAIIGYLKS---------DSSLRRKWLDEGQKKVVLKVKSLEELLGIKHKAESLGL 73  Archaeoglobus fulgidus
2ZV3_A  75 PCSIIRDAGHTQLEPGTLTAVAIGPEKDEKIDKITGHLKLL 115 Methanocaldococcus jannaschii DSM 2661
Q60363  75 PCSIIRDAGHTQLEPGTLTAVAIGPEKDEKIDKITGHLKLL 115 Methanocaldococcus jannaschii DSM 2661
O27732  72 SNYLVRDAGHTQIPAGTITCLGIGPDDDEKIDKITGDLKLL 112 Methanothermobacter thermautotrophicus str. Delta H
O28185  74 VTGLVQDAGLTEVPPGTITAVVIGPDEERKIDKVTGNLPLL 114 Archaeoglobus fulgidus DSM 4304
P34222 168 NAAVIHDAGRTQIAAGSATVLGLGPAPKAVLDQITGDLKLY 208 Saccharomyces cerevisiae S288c
1RZW_A  74 VTGLVQDAGLTEVPPGTITAVVIGPDEERKIDKVTGNLPLL 114 Archaeoglobus fulgidus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap