4B2O,1T71


Conserved Protein Domain Family
TIGR00282

?
TIGR00282: TIGR00282 
Click on image for an interactive view with Cn3D
metallophosphoesterase, MG_246/BB_0505 family
A member of this family from Mycoplasma Pneumoniae has been crystallized and described as a novel phosphatase. [Unknown function, Enzymes of unknown specificity]
Statistics
?
PSSM-Id: 161802
View PSSM: TIGR00282
Aligned: 5 rows
Threshold Bit Score: 423.472
Threshold Setting Gi: 488732664
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4B2O_A         1 MRILFIGDVVGSPGRDMVKEYVPKLKTKYKPHFTIINGENAAHGKGLTEKIYHSLIQSGADAITMGNHTWDKKEIFDFID 80  Bacillus subtil...
P75429         5 IKFIFLGDVYGKAGRNIIKNNLAQLKSKYQADLVIVNAENTTHGKGLSLKHYEFLKEAGVNYITMGNHTWFQKLDLAVVI 84  Mycoplasma pneu...
P47488         4 IKVLFLGDVYGKAGRKIISDHLPIIKKKYQLNLIIANAENTTNGKGLSWNHYQILKQAGIDYITMGNHTWFQKQDLELVL 83  Mycoplasma geni...
1T71_A         5 IKFIFLGDVYGKAGRNIIKNNLAQLKSKYQADLVIVNAENTTHGKGLSLKHYEFLKEAGVNYITMGNHTWFQKLDLAVVI 84  Mycoplasma pneu...
WP_002656072   6 IKTLIIGDIIGESGLKKVFFNLKNIKNKYRIDLVIANGENSSNGFGITPEIANNLFRSGVNVITTGNHVYSNCKINDYLN 85  Lyme disease sp...
4B2O_A        81 DVPNLVRPANFPEGTP----GKGITYVKANGKELAVINLQGRTFLPP--LDDPFLKADELIaeAAKRTPYIFIDFHAEAT 154 Bacillus subtil...
P75429        85 NKKDLVRPLNLDTSFAfhnlGQGSLVFEFNKAKIRITNLLGTSVPLPfkTTNPFKVLKELI--LKRDCDLHIVDFHAETT 162 Mycoplasma pneu...
P47488        84 NQVDVIRPLNLMQDFNyfqlGKGSYLFSLNGLKIRITNLLGTSINLPfaITNPFVELKKLV--LTKDCDLHIVDFHAETT 161 Mycoplasma geni...
1T71_A        85 NKKDLVRPLNLDTSFAfhnlGQGSLVFEFNKAKIRITNLLGTSVPLPfkTTNPFKVLKELI--LKRDCDLHIVDFHAETT 162 Mycoplasma pneu...
WP_002656072  86 KQTYILRPNNFSDLLD----GHGYCFLTIRDEKVAVVNVQG-VLNMNfiVKNPFDNTKKLVnmLSNKAKTIFVDFHAESN 160 Lyme disease sp...
4B2O_A       155 SEKLALGWYTDGRASAVVGTHTHVQTADNRILPKGTAYITDVGMTGP-YDGILGMDRETIIKRFKTNLPVRFTVAEGKTT 233 Bacillus subtil...
P75429       163 SEKNAFCMAFDGYVTTIFGTHTHVPSADLRITPKGSAYITDVGMCGPgFGSVIGANPEQSIRLFCAGSREHFEVSKCGAQ 242 Mycoplasma pneu...
P47488       162 SEKNAFCMVFDGYVTAILGTHTHVPSNDLRITPKGSVYITDVGMCGPgFGSVIGANPKQSIKLFCTGERQFFEVSNCGAQ 241 Mycoplasma geni...
1T71_A       163 SEKNAFCMAFDGYVTTIFGTHTHVPSADLRITPKGSAYITDVGMCGPgFGSVIGANPEQSIRLFCAGSREHFEVSKCGAQ 242 Mycoplasma pneu...
WP_002656072 161 YEKESFGYFLNGFVTGVVGTHTHVMTQDERILSKGTAYISDIGMTGG-LNSVIGFNPDISLKGLLEYTPLRAEVVEDDTI 239 Lyme disease sp...
4B2O_A       234 LSGVVIDIDDQTKKAVKIERILIN-DDHMFFE 264 Bacillus subtilis subsp. subtilis str. 168
P75429       243 LNGVFFEVDVNTKKVIKTEAIRIVeDDPRYLK 274 Mycoplasma pneumoniae M129
P47488       242 LNGVFFEVCSKTNQVVKIEQIRIVlDDEKYLA 273 Mycoplasma genitalium G37
1T71_A       243 LNGVFFEVDVNTKKVIKTEAIRIVeDDPRYLK 274 Mycoplasma pneumoniae M129
WP_002656072 240 LQGVIITSNLKTGRALKIERIQK--------- 262 Lyme disease spirochete
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap