3IZS


Conserved Protein Domain Family
uL16_euk_arch

?
TIGR00279: uL16_euk_arch 
Click on image for an interactive view with Cn3D
ribosomal protein uL16(L10.e), eukarotic/archaeal form
This model finds the archaeal and eukaryotic forms of ribosomal protein uL16, previously L10.e. The protein is encoded by multiple loci in some eukaryotes and has been assigned a number of extra-ribosomal functions, some of which will require re-evaluation in the context of identification as a ribosomal protein. L10.e is distantly related to eubacterial ribosomal protein L16. [Protein synthesis, Ribosomal proteins: synthesis and modification]
Statistics
?
PSSM-Id: 129380
View PSSM: TIGR00279
Aligned: 5 rows
Threshold Bit Score: 275.584
Threshold Setting Gi: 6093993
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3IZS_I   1 MARRPARCYRYQKNKPYPKSRYNRAVPDSKIRIYDLGKKkatVDEFPLCVHLVSNELEQLSSEALEAARICANKYMTTVS 80  Saccharomyces cerevis...
Q57963   2 ASLRPNRCYRDVDKPPYTRKEYVKGVPQPKVVHFIMGNL---SAEFPVKVNLVATRPIQIRHNALEAARVAANKYLTKMC 78  Methanocaldococcus ja...
O28930   1 MARKPARMWR-RLERPYTRTEYIDGAPGTRVRMFDMGNK---SADFPVMLTLVAKEAVQIRENALEAARVVANKYVSRRA 76  Archaeoglobus fulgidu...
O27191   1 ------------MVRAYTRREYIKKIPGSKIVQYDMGNL---SAEFPISLSVAVKAPTQITHNALEAARIASNRYMQRRA 65  Methanothermobacter t...
P41805   1 MARRPARCYRYQKNKPYPKSRYNRAVPDSKIRIYDLGKKkatVDEFPLCVHLVSNELEQLSSEALEAARICANKYMTTVS 80  Saccharomyces cerevis...
3IZS_I  81 GRDAFHLRVRVHPFHVLRINKMLSCAGADRLQQGMRGAWGKPHGLAARVDIGQIIFSVRTKDSNKDVVVEGLRRARYKFP 160 Saccharomyces cerevis...
Q57963  79 GRMGYKFQIRVYPHQILREHKMATGAGADRISDGMRLAFGKPIGTAARVKEGQAILTVWVNPDKFPAAKEALRRAAMKLP 158 Methanocaldococcus ja...
O28930  77 GASNYKLKLRIFPHHILREHKMAVGAGADRISQGMRAAFGKPVGRAARVKPGTKIMSVWVKPEHFEIAKEALRRAAMKMP 156 Archaeoglobus fulgidu...
O27191  66 GRMGYHLKIRVYPHHIVRENPMATGAGADRVQDGMRKAFGKPVSTVALVKKNQKIITIETNKKNFKDAKEALRRAAMKFP 145 Methanothermobacter t...
P41805  81 GRDAFHLRVRVHPFHVLRINKMLSCAGADRLQQGMRGAWGKPHGLAARVDIGQIIFSVRTKDSNKDVVVEGLRRARYKFP 160 Saccharomyces cerevis...
3IZS_I 161 GQQKIILSKKWgftnldrpEYLK 183 Saccharomyces cerevisiae S288c
Q57963 159 VPCRIVIEQGK--------ELLK 173 Methanocaldococcus jannaschii DSM 2661
O28930 157 TPTKIVVEKGH--------ELLK 171 Archaeoglobus fulgidus DSM 4304
O27191 146 VPCRIVIDRGE--------ELVK 160 Methanothermobacter thermautotrophicus str. Delta H
P41805 161 GQQKIILSKKWgftnldrpEYLK 183 Saccharomyces cerevisiae S288c
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap