Conserved Protein Domain Family
TIGR00273

?
TIGR00273: TIGR00273 
iron-sulfur cluster-binding protein
Members of this family have a perfect 4Fe-4S binding motif C-x(2)-C-x(2)-C-x(3)-CP followed by either a perfect or imperfect (the first Cys replaced by Ser) second copy. Members probably bind two 4fe-4S iron-sulfur clusters. [Energy metabolism, Electron transport]
Statistics
?
PSSM-Id: 129374
View PSSM: TIGR00273
Aligned: 4 rows
Threshold Bit Score: 564.109
Threshold Setting Gi: 499180774
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P77536        18 IEDPIMRKAVANAQQRIGANRQ-KMVDELGHWEEWRDRAAQIRDHVLSNLDAYLYQLSEKVTQNGGHVYFARTKEDATRY 96  Escherichia col...
WP_003228307  18 IDNEFMRGAVSGAQERLRTRRL-EAAEELGNWEEWRSLSEEIRQHVLENLDFYLGQLAENVAKRGGHVYFAKTAEEASSY 96  Bacillus subtilis
WP_000417304  18 LGDMQLRENLRSAMDTLRANRKnLLKNRYSEWENLRELGKEVKLKILSRLDEYLELFEKNATQNGFKIHYAKDGDEANEI 97  Helicobacter py...
WP_010878314  12 IKEGILR-SLRNLSENVRRN-----VENHPYLIDFAEDVKSAKLKVAENYDFWIDKAKDVLESRGVNVYYAESAEEARKI 85  Archaeoglobus f...
P77536        97 ILQVAQRKNARKVVKSKSMVTEEIGVNHVLQDAGIQVIETDLGEYILQLD-QDPPSHVVVPAIHKDRHQIRRVLHERLGY 175 Escherichia col...
WP_003228307  97 IRDVIQKKNGKKIVKSKSMVTEEINLNEVLEKEGCEVVETDLGEYILQIDdHDPPSHIVAPALHKNKEQIRDVFKERLDY 176 Bacillus subtilis
WP_000417304  98 IYNLAKEKNIKRILKQKSMASEEIGLNHYLKEKGIQAQETDLGELIIQLI-NEHPVHIVVPAIHKNRKQIGKIFEEKLNA 176 Helicobacter py...
WP_010878314  86 AGKVVGE--GKLVVKAKSMVSEEIHLREWLEKIGNEVWETDLGELIVQVA-GDKPMHMVIPALHYSEQEVGEILK-RIGV 161 Archaeoglobus f...
P77536       176 EGPETPEAMTLFIRQKIREDFLSAEIGITGCNFAVAETGSVCLVTNEGNARMCTTLPKTHIAVMGMERIAPTFAEVDVLI 255 Escherichia col...
WP_003228307 177 QHTEKPEELVMHARAILRKKFLEADIGITGCNFAIADTGSVSLVTNEGNGRLVSTLPKTQITVMGMERIVPSFSEFEVLV 256 Bacillus subtilis
WP_000417304 177 AYEEEPEKLNAIARKHMRKEFESFKMGISGVNFAIANEGAIWLVENEGNGRMSTTACDVHVAICGIEKLVESFDDAAILN 256 Helicobacter py...
WP_010878314 162 EG-ESAEVLAREVRKFMREKFLKADVGVSGCNAFSAETGRIFLIENEGNIRLSTSLPKTYLALVSIEKILPT--DELCLK 238 Archaeoglobus f...
P77536       256 TMLARSA-VGARLTGYNTWLTGPREAGHVDGPEEFHLVIVDNGRSEVLASE-FRDVLRCIRCGACMNTCPAYRHIGGHGY 333 Escherichia col...
WP_003228307 257 SMLTRSA-VGQRLTSYITALTGPKLEGEVDGPEEFHLVIVDNGRSNILGTE-FQSVLQCIRCAACINVCPVYRHVGGHSY 334 Bacillus subtilis
WP_000417304 257 NLLAPSA-VGVPITCYQNIITGPRKEGDLDGPKEAHIILLDNNRSNILADEkYYRALSCIRCGTCLNHCPVYDKIGGHAY 335 Helicobacter py...
WP_010878314 239 SICVQSAfFGTFPPAYINVNEKVQQQ---D----MHVILLDNGR-K--NTQ-FREQLACVRCGRCQLECPVFQLAGNVWG 307 Archaeoglobus f...
P77536       334 GSIYPGPIGAVISPLLGGYKDFKDLPYACSLCTACDNVCPVRIPLSKLILRHRRVMAEK-GI----------TAKAEQRA 402 Escherichia col...
WP_003228307 335 GSIYSGPIGAVLSPLLGGYDDYKELPYASSLCAACSEACPVKIPLHELLLKHRQNIVEKeGR----------APISEKLA 404 Bacillus subtilis
WP_000417304 336 LSTYPGPIGVVVSPQLFGLNNYGHIPNLCSLCGRCTEVCPVEIPLAELIRDLRSDKVGE-GRgvikgakstqHSGMEKFS 414 Helicobacter py...
WP_010878314 308 GEVYGGPMGMIWSAITDAITDY---CFLSTLCGKCREVCPMKIDMPRMIREIR------------------------KLA 360 Archaeoglobus f...
P77536       403 IKMFAYANSHPGLWKVGMMAGahaaSWFINGGKTPLKFGA-ISDWMEARDLP 453 Escherichia coli K-12
WP_003228307 405 MKAFGLGASSLSLYKMGSKWApaamTPFTEDEKISKGPGP-LKNWTQIRDFP 455 Bacillus subtilis
WP_000417304 415 MKMFAKMASDGAKWRFQLKMA----QFFSPLGKLLAPILPlVKEWASVRTLP 462 Helicobacter pylori
WP_010878314 361 LKLD------------------------------------------------ 364 Archaeoglobus fulgidus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap